Overview

  • Product name

  • Description

    Rabbit polyclonal to CD13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CD13 aa 34-219.
    Sequence:

    SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPD SYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQ GHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFE GELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK


    Database link: P15144

  • Positive control

    • WB: Mouse kidney lysate. IHC-P: Human kidney and liver tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 110 kDa.

Target

  • Function

    Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types including small intestinal and tubular epithelial cells, macrophages, granulocytes and synaptic membranes from the CNS. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.
  • Tissue specificity

    Expressed in epithelial cells of the kidney, intestine, and respiratory tract; granulocytes, monocytes, fibroblasts, endothelial cells, cerebral pericytes at the blood-brain barrier, synaptic membranes of cells in the CNS. Also expressed in endometrial stromal cells, but not in the endometrial glandular cells. Found in the vasculature of tissues that undergo angiogenesis and in malignant gliomas and lymph node metastases from multiple tumor types but not in blood vessels of normal tissues. A soluble form has been found in plasma. It is found to be elevated in plasma and effusions of cancer patients.
  • Sequence similarities

    Belongs to the peptidase M1 family.
  • Domain

    Amino acids 260-353 are essential to mediate susceptibility to infection with HCoV-229E (in porcine/human chimeric studies) and more specifically amino acids 288-295 (mutagenesis studies).
  • Post-translational
    modifications

    Sulfated.
    N- and O-glycosylated.
    May undergo proteolysis and give rise to a soluble form.
  • Cellular localization

    Cell membrane. Cytoplasm > cytosol. A soluble form has also been detected.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alanyl (membrane) aminopeptidase antibody
    • Alanyl aminopeptidase antibody
    • Aminopeptidase M antibody
    • Aminopeptidase N antibody
    • AMPN_HUMAN antibody
    • ANPEP antibody
    • AP M antibody
    • AP N antibody
    • AP-M antibody
    • AP-N antibody
    • APN antibody
    • CD 13 antibody
    • CD13 antibody
    • CD13 antigen antibody
    • gp150 antibody
    • hAPN antibody
    • LAP 1 antibody
    • LAP1 antibody
    • Microsomal aminopeptidase antibody
    • Myeloid plasma membrane glycoprotein CD13 antibody
    • p150 antibody
    • PEPN antibody
    see all

Images

  • Anti-CD13 antibody (ab236283) at 1/500 dilution + Mouse kidney lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 110 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling CD13 using ab236283 at 1/100 dilution in IC/IF, followed by an Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human liver tissue stained for CD13 using ab236283 at 1/100 dilution on immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for CD13 using ab236283 at 1/100 dilution on immunohistochemical analysis.

References

ab236283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up