Overview

  • Product name

    Anti-CD130 (gp130) antibody
    See all CD130 (gp130) primary antibodies
  • Description

    Rabbit polyclonal to CD130 (gp130)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 158-207 (

    FTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKV

    ) of Human CD130(gp130) isoform 2 (NP_786943).

  • Positive control

    • MDA-MB-435S Cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab128618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Signal-transducing molecule. The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize gp130 for initiating signal transmission. Binds to IL6/IL6R (alpha chain) complex, resulting in the formation of high-affinity IL6 binding sites, and transduces the signal. Does not bind IL6. May have a role in embryonic development (By similarity). The type I OSM receptor is capable of transducing OSM-specific signaling events.
  • Tissue specificity

    Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Post-translational
    modifications

    Phosphorylation of Ser-782 down-regulates cell surface expression.
    Heavily N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD130 antibody
    • CD130 antigen antibody
    • CDw130 antibody
    • gp130 antibody
    • GP130 RAPS antibody
    • IL 6R beta antibody
    • IL-6 receptor subunit beta antibody
    • IL-6R subunit beta antibody
    • IL-6R-beta antibody
    • IL-6RB antibody
    • IL6 ST antibody
    • IL6RB_HUMAN antibody
    • IL6ST antibody
    • Interleukin 6 receptor subunit beta antibody
    • Interleukin receptor beta chain antibody
    • Interleukin-6 receptor subunit beta antibody
    • Interleukin-6 signal transducer antibody
    • Membrane glycoprotein 130 antibody
    • Membrane glycoprotein gp130 antibody
    • Oncostatin M receptor antibody
    • Oncostatin M receptor alpha subunit antibody
    • Oncostatin-M receptor subunit alpha antibody
    see all

Images

  • Anti-CD130 (gp130) antibody (ab128618) at 1 µg/ml + MDA-MB-435S cell lysate

    Predicted band size: 40 kDa



    Gel concentration: 6-18%

References

ab128618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up