Overview

  • Product name

    Anti-CD134 / OX40L receptor antibody
    See all CD134 / OX40L receptor primary antibodies
  • Description

    Rabbit polyclonal to CD134 / OX40L receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD134/ OX40L receptor aa 110-160 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPAS N


    Database link: P43489

  • Positive control

    • IHC-P: Rat lung tissue; Mouse spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 29 kDa.
IHC-P 1/100 - 1/500.

1/50-1/200 when using fluorescent detection methods.

Target

  • Function

    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACT 35 antibody
    • ACT35 antibody
    • ACT35 antigen antibody
    • ATC35 antigen antibody
    • CD 134 antibody
    • CD134 antibody
    • CD134 antigen antibody
    • IMD16 antibody
    • Lymphoid activation antigene ACT35 antibody
    • OX 40 antibody
    • OX40 antibody
    • OX40 antigen antibody
    • OX40 cell surface antigen antibody
    • OX40 homologue antibody
    • OX40L receptor antibody
    • TAX transcriptionally activated glycoprotein 1 receptor antibody
    • TAX transcriptionally-activated glycoprotein 1 receptor antibody
    • TNF receptor superfamily member 4 antibody
    • TNFRSF 4 antibody
    • TNFRSF4 antibody
    • TNR4_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 4 antibody
    • Txgp 1l antibody
    • Txgp1 antibody
    • Txgp1l antibody
    see all

Images

  • Formaldehyde-fixed, paraffin-embedded mouse spleen tissue stained for CD134 / OX40L receptor using ab203220 at 1/200 dilution in immunohistochemical analysis.

  • Formaldehyde-fixed, paraffin-embedded mouse spleen tissue stained for CD134 / OX40L receptor using ab203220 at 1/200 dilution in immunohistochemical analysis.

    See Abreview

References

This product has been referenced in:

  • Liu T  et al. Immunomodulatory effects of OX40Ig gene-modified adipose tissue-derived mesenchymal stem cells on rat kidney transplantation. Int J Mol Med 39:144-152 (2017). WB ; Rat . Read more (PubMed: 27878248) »
  • Wang J  et al. PD-1 Blockade Prevents the Development and Progression of Carcinogen-Induced Oral Premalignant Lesions. Cancer Prev Res (Phila) 10:684-693 (2017). Read more (PubMed: 29018057) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9.0
Permeabilization
No
Specification
spleen
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 15% · Temperature: RT°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Feb 19 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9.0
Permeabilization
No
Specification
spleen
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 15% · Temperature: RT°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Feb 14 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: High pH
Permeabilization
No
Specification
Mouse spleen
Blocking step
Serum as blocking agent for 10 minute(s) · Concentration: 2.5% · Temperature: 37°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 13 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up