Overview

  • Product name

  • Description

    Rabbit polyclonal to CD137
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD137 aa 115-188.
    Sequence:

    KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPAD LSPGASSVTPPAPAREPGHSPQII


    Database link: Q07011

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 1BB antibody
    • 4 1BB ligand receptor antibody
    • 4-1BB ligand receptor antibody
    • 4-1BB Ligand Receptor T Cell antibody
    • 4-1BB, mouse, homolog of antibody
    • Antigen 4-1BB Homolog antibody
    • CD 137 antibody
    • CD137 antibody
    • CD137 antigen antibody
    • CDw137 antibody
    • HLDA VI antibody
    • Homolog of mouse 4 1BB antibody
    • ILA antibody
    • induced by lymphocyte activation (ILA) antibody
    • Induced by lymphocyte activation antibody
    • Interleukin activated receptor homolog of mouse Ly63 antibody
    • Ly63, mouse, homolog of antibody
    • MGC2172 antibody
    • OTTHUMP00000044294 antibody
    • Receptor protein 4 1BB antibody
    • T cell antigen 4 1BB homolog antibody
    • T cell antigen ILA antibody
    • T-cell antigen 4-1BB homolog antibody
    • T-cell antigen ILA antibody
    • TNF receptor superfamily member 9 antibody
    • TNFRSF9 antibody
    • TNR9_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 9 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CD137 (green) using ab222213 at 4 µg/ml in ICC/IF.

References

ab222213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up