Overview

  • Product name

  • Description

    Rabbit polyclonal to CD137
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human CD137 aa 40-153. (Expressed in E.coli).
    Sequence:

    NRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCT PGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNC SLDGKSVLVNGTKE


    Database link: Q07011

  • Positive control

    • WB: Recombinant human CD137 protein; Rat marrow and thymus lysates; Rat and pig serum. IHC-P: Human kidney cancer, liver, stomach and thyroid cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 1BB antibody
    • 4 1BB ligand receptor antibody
    • 4-1BB ligand receptor antibody
    • 4-1BB Ligand Receptor T Cell antibody
    • 4-1BB, mouse, homolog of antibody
    • Antigen 4-1BB Homolog antibody
    • CD 137 antibody
    • CD137 antibody
    • CD137 antigen antibody
    • CDw137 antibody
    • HLDA VI antibody
    • Homolog of mouse 4 1BB antibody
    • ILA antibody
    • induced by lymphocyte activation (ILA) antibody
    • Induced by lymphocyte activation antibody
    • Interleukin activated receptor homolog of mouse Ly63 antibody
    • Ly63, mouse, homolog of antibody
    • MGC2172 antibody
    • OTTHUMP00000044294 antibody
    • Receptor protein 4 1BB antibody
    • T cell antigen 4 1BB homolog antibody
    • T cell antigen ILA antibody
    • T-cell antigen 4-1BB homolog antibody
    • T-cell antigen ILA antibody
    • TNF receptor superfamily member 9 antibody
    • TNFRSF9 antibody
    • TNR9_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 9 antibody
    see all

Images

  • Paraffin-embedded human kidney cancer tissue stained for CD137 using ab232990 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for CD137 using ab232990 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for CD137 using ab232990 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human thyroid cancer tissue stained for CD137 using ab232990 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD137 antibody (ab232990) at 2 µg/ml + Recombinant human CD137 prtein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-CD137 antibody (ab232990) at 2 µg/ml

    Lane 1 : Rat marrow lysate
    Lane 2 : Rat thymus lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • Anti-CD137 antibody (ab232990) at 1 µg/ml + Rat serum

    Predicted band size: 28 kDa

  • Anti-CD137 antibody (ab232990) at 1 µg/ml + Pig serum

    Predicted band size: 28 kDa

References

ab232990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up