Overview

  • Product name

    Anti-CD137 antibody (Biotin)
    See all CD137 primary antibodies
  • Description

    Goat polyclonal to CD137 (Biotin)
  • Host species

    Goat
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity


    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD137 aa 19-184. Produced in E.coli.
    Sequence:

    MERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQ CKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGC KNCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSP GASSVTPPAPAREPGHS


    Database link: Q07011

  • Positive control

    • WB: Recombinant human CD137 protein. sELISA: Recombinant human CD137 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab245844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 28 kDa.
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.

Target

  • Function

    Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.
  • Tissue specificity

    Expressed on the surface of activated T-cells.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 1BB antibody
    • 4 1BB ligand receptor antibody
    • 4-1BB ligand receptor antibody
    • 4-1BB Ligand Receptor T Cell antibody
    • 4-1BB, mouse, homolog of antibody
    • Antigen 4-1BB Homolog antibody
    • CD 137 antibody
    • CD137 antibody
    • CD137 antigen antibody
    • CDw137 antibody
    • HLDA VI antibody
    • Homolog of mouse 4 1BB antibody
    • ILA antibody
    • induced by lymphocyte activation (ILA) antibody
    • Induced by lymphocyte activation antibody
    • Interleukin activated receptor homolog of mouse Ly63 antibody
    • Ly63, mouse, homolog of antibody
    • MGC2172 antibody
    • OTTHUMP00000044294 antibody
    • Receptor protein 4 1BB antibody
    • T cell antigen 4 1BB homolog antibody
    • T cell antigen ILA antibody
    • T-cell antigen 4-1BB homolog antibody
    • T-cell antigen ILA antibody
    • TNF receptor superfamily member 9 antibody
    • TNFRSF9 antibody
    • TNR9_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 9 antibody
    see all

Images

  • To detect human CD137 by Western Blot analysis ab245844 can be used at a concentration of 0.1 - 0.2 µg/ml.

    Used in conjunction with compatible secondary reagents the detection limit for recombinant human CD137 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human CD137, respectively.

    Non-reducing conditions.

  • To detect human CD137 by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245844 is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human CD137.

References

ab245844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up