Anti-CD14 antibody [1H5D8] (ab181470)
Key features and details
- Mouse monoclonal [1H5D8] to CD14
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CD14 antibody [1H5D8]
See all CD14 primary antibodies -
Description
Mouse monoclonal [1H5D8] to CD14 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
Sequence:TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA
Database link: P08571 -
Positive control
- WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1H5D8 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181470 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
1/200 - 1/1000.
|
|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 40 kDa.
|
Notes |
---|
ICC/IF
1/200 - 1/1000. |
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 40 kDa. |
Target
-
Function
Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. -
Tissue specificity
Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. -
Sequence similarities
Contains 11 LRR (leucine-rich) repeats. -
Post-translational
modificationsN- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 929 Human
- Omim: 158120 Human
- SwissProt: P08571 Human
- Unigene: 163867 Human
-
Alternative names
- CD 14 antibody
- CD_antigen=CD14 antibody
- CD14 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution
Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Predicted band size: 40 kDa -
Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein
Predicted band size: 40 kDaExpected MWt is 46.8 kDa.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (10)
ab181470 has been referenced in 10 publications.
- Wu M et al. FSTL1 promotes growth and metastasis in gastric cancer by activating AKT related pathway and predicts poor survival. Am J Cancer Res 11:712-728 (2021). PubMed: 33791149
- León-Rivera R et al. Central Nervous System (CNS) Viral Seeding by Mature Monocytes and Potential Therapies To Reduce CNS Viral Reservoirs in the cART Era. mBio 12:N/A (2021). PubMed: 33727362
- Carrasco-Pozo C et al. Hemin Prevents Increased Glycolysis in Macrophages upon Activation: Protection by Microbiota-Derived Metabolites of Polyphenols. Antioxidants (Basel) 9:N/A (2020). PubMed: 33187129
- Huang M et al. The Influence of Immune Heterogeneity on the Effectiveness of Immune Checkpoint Inhibitors in Multifocal Hepatocellular Carcinomas. Clin Cancer Res 26:4947-4957 (2020). PubMed: 32527942
- Greiffo FR et al. CX3CR1-fractalkine axis drives kinetic changes of monocytes in fibrotic interstitial lung diseases. Eur Respir J 55:N/A (2020). PubMed: 31744836
- Lopes-Coelho F et al. Monocytes as Endothelial Progenitor Cells (EPCs), Another Brick in the Wall to Disentangle Tumor Angiogenesis. Cells 9:N/A (2020). PubMed: 31906296
- Russo E et al. Energy Metabolism Analysis of Three Different Mesenchymal Stem Cell Populations of Umbilical Cord Under Normal and Pathologic Conditions. Stem Cell Rev Rep 16:585-595 (2020). PubMed: 32185666
- Han Q et al. Circulating Tie2-Expressing Monocytes: A Potential Biomarker for Cervical Cancer. Onco Targets Ther 13:8877-8885 (2020). PubMed: 32982281
- Wang Q & Su L Vpr Enhances HIV-1 Env Processing and Virion Infectivity in Macrophages by Modulating TET2-Dependent IFITM3 Expression. mBio 10:N/A (2019). PubMed: 31431548
- Genin M et al. M1 and M2 macrophages derived from THP-1 cells differentially modulate the response of cancer cells to etoposide. BMC Cancer 15:577 (2015). ICC/IF ; Human . PubMed: 26253167