Anti-CD14 antibody [1H5D8] (ab181470)

Submit a review Submit a question References (5)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
  • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
  • Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
  • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)

Key features and details

  • Mouse monoclonal [1H5D8] to CD14
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG2a

Overview

  • Product name

    Anti-CD14 antibody [1H5D8]
    See all CD14 primary antibodies

  • Description

    Mouse monoclonal [1H5D8] to CD14

  • Host species

    Mouse

  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
    Sequence:

    TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA


    Database link: P08571
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab181470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/1000.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.

Target

  • Function

    Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

  • Tissue specificity

    Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages.

  • Sequence similarities

    Contains 11 LRR (leucine-rich) repeats.

  • Post-translational
    modifications

    N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

  • Cellular localization

    Cell membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • CD 14 antibody
      • CD_antigen=CD14 antibody
      • CD14 antibody
      • CD14 antigen antibody
      • CD14 molecule antibody
      • CD14_HUMAN antibody
      • LPS-R antibody
      • Mo2 antibody
      • Monocyte differentiation antigen CD14 antibody
      • Monocyte differentiation antigen CD14 urinary form antibody
      • Monocyte differentiation antigen CD14, membrane-bound form antibody
      • Myeloid cell specific leucine rich glycoprotein antibody
      • Myeloid cell-specific leucine-rich glycoprotein antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.

    • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution

      Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
      Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

      Predicted band size: 40 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.

    • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein

      Predicted band size: 40 kDa



      Expected MWt is 46.8 kDa.

    References (5)

    Publishing research using ab181470? Please let us know so that we can cite the reference in this datasheet.

    ab181470 has been referenced in 5 publications.

    • Lopes-Coelho F  et al. Monocytes as Endothelial Progenitor Cells (EPCs), Another Brick in the Wall to Disentangle Tumor Angiogenesis. Cells 9:N/A (2020). PubMed: 31906296
    • Russo E  et al. Energy Metabolism Analysis of Three Different Mesenchymal Stem Cell Populations of Umbilical Cord Under Normal and Pathologic Conditions. Stem Cell Rev Rep 16:585-595 (2020). PubMed: 32185666
    • Han Q  et al. Circulating Tie2-Expressing Monocytes: A Potential Biomarker for Cervical Cancer. Onco Targets Ther 13:8877-8885 (2020). PubMed: 32982281
    • Wang Q & Su L Vpr Enhances HIV-1 Env Processing and Virion Infectivity in Macrophages by Modulating TET2-Dependent IFITM3 Expression. mBio 10:N/A (2019). PubMed: 31431548
    • Genin M  et al. M1 and M2 macrophages derived from THP-1 cells differentially modulate the response of cancer cells to etoposide. BMC Cancer 15:577 (2015). ICC/IF ; Human . PubMed: 26253167

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab181470.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com