Anti-CD14 antibody [1H5D8] (ab181470)
Key features and details
- Mouse monoclonal [1H5D8] to CD14
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CD14 antibody [1H5D8]
See all CD14 primary antibodies -
Description
Mouse monoclonal [1H5D8] to CD14 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
Sequence:TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA
Database link: P08571 -
Positive control
- WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1H5D8 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab181470 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/200 - 1/1000. | |
IHC-P | 1/200 - 1/1000. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 40 kDa. |
Target
-
Function
Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. -
Tissue specificity
Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. -
Sequence similarities
Contains 11 LRR (leucine-rich) repeats. -
Post-translational
modificationsN- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 929 Human
- Omim: 158120 Human
- SwissProt: P08571 Human
- Unigene: 163867 Human
-
Alternative names
- CD 14 antibody
- CD_antigen=CD14 antibody
- CD14 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution
Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
Predicted band size: 40 kDa -
Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.
-
Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein
Predicted band size: 40 kDaExpected MWt is 46.8 kDa.
Protocols
Datasheets and documents
References (5)
ab181470 has been referenced in 5 publications.
- Lopes-Coelho F et al. Monocytes as Endothelial Progenitor Cells (EPCs), Another Brick in the Wall to Disentangle Tumor Angiogenesis. Cells 9:N/A (2020). PubMed: 31906296
- Russo E et al. Energy Metabolism Analysis of Three Different Mesenchymal Stem Cell Populations of Umbilical Cord Under Normal and Pathologic Conditions. Stem Cell Rev Rep 16:585-595 (2020). PubMed: 32185666
- Han Q et al. Circulating Tie2-Expressing Monocytes: A Potential Biomarker for Cervical Cancer. Onco Targets Ther 13:8877-8885 (2020). PubMed: 32982281
- Wang Q & Su L Vpr Enhances HIV-1 Env Processing and Virion Infectivity in Macrophages by Modulating TET2-Dependent IFITM3 Expression. mBio 10:N/A (2019). PubMed: 31431548
- Genin M et al. M1 and M2 macrophages derived from THP-1 cells differentially modulate the response of cancer cells to etoposide. BMC Cancer 15:577 (2015). ICC/IF ; Human . PubMed: 26253167