Anti-CD14 antibody [1H5D8] (ab181470)

Submit a review Submit a question References (1)

Overview

  • Product name

    Anti-CD14 antibody [1H5D8]
    See all CD14 primary antibodies

  • Description

    Mouse monoclonal [1H5D8] to CD14

  • Host species

    Mouse

  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human CD14 aa 20-214. (Expressed in E.coli).
    Sequence:

    TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPF LKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLK ELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA


    Database link: P08571

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Human CD14 (aa 20-214) recombinant protein; CD14 (aa 20-214)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer and colon tissues. ICC/IF: HepG2 cells.

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR281538-10 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/1000.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.

Target

  • Function

    Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

  • Tissue specificity

    Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages.

  • Sequence similarities

    Contains 11 LRR (leucine-rich) repeats.

  • Post-translational
    modifications

    N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

  • Cellular localization

    Cell membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • CD 14 antibody
      • CD_antigen=CD14 antibody
      • CD14 antibody
      • CD14 antigen antibody
      • CD14 molecule antibody
      • CD14_HUMAN antibody
      • LPS-R antibody
      • Mo2 antibody
      • Monocyte differentiation antigen CD14 antibody
      • Monocyte differentiation antigen CD14 urinary form antibody
      • Monocyte differentiation antigen CD14, membrane-bound form antibody
      • Myeloid cell specific leucine rich glycoprotein antibody
      • Myeloid cell-specific leucine-rich glycoprotein antibody
      see all

    Images

    • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      All lanes : Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution

      Lane 1 : Non-transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate
      Lane 2 : CD14 (aa 20-214)-hIgGFc transfected HEK-293 (Human epithelial cell line from embryonic kidney) cell lysate

      Predicted band size: 40 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunocytochemistry/ Immunofluorescence - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunofluorescent analysis of HepG2 (Human liver hepatocellular carcinoma cell line) cells labeling CD14 with ab181470 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunohistochemical analysis of paraffin-embedded human colon tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD14 antibody [1H5D8] (ab181470)

      Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue labeling CD14 with ab181470 at 1/200 dilution with DAB staining.

    • Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Western blot - Anti-CD14 antibody [1H5D8] (ab181470)
      Anti-CD14 antibody [1H5D8] (ab181470) at 1/500 dilution + Human CD14 (aa 20-214) recombinant protein

      Predicted band size: 40 kDa



      Expected MWt is 46.8 kDa.

    References

    This product has been referenced in:

    • Genin M  et al. M1 and M2 macrophages derived from THP-1 cells differentially modulate the response of cancer cells to etoposide. BMC Cancer 15:577 (2015). ICC/IF ; Human . Read more (PubMed: 26253167) »
    See 1 Publication for this product

    Publishing research using ab181470? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab181470.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com