Overview

  • Product name

  • Description

    Rabbit polyclonal to CD146
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD146 aa 200-250 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPT E


    Database link: P43121

  • Positive control

    • Human cervical carcinoma tissue. Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 72 kDa.
Flow Cyt 1/20 - 1/100.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2, and a transient increase in the intracellular calcium concentration.
  • Tissue specificity

    Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A32 antigen antibody
    • CD 146 antibody
    • CD146 antibody
    • CD146 antigen antibody
    • Cell surface glycoprotein MUC18 antibody
    • Cell surface glycoprotein P1H12 antibody
    • Gicerin antibody
    • Mcam antibody
    • Melanoma adhesion molecule antibody
    • Melanoma associated antigen A32 antibody
    • Melanoma associated antigen MUC18 antibody
    • Melanoma associated glycoprotein MUC18 antibody
    • Melanoma cell adhesion molecule antibody
    • Melanoma-associated antigen A32 antibody
    • Melanoma-associated antigen MUC18 antibody
    • MelCAM antibody
    • MUC 18 antibody
    • MUC18 antibody
    • MUC18_HUMAN antibody
    • S endo 1 antibody
    • S endo 1 endothelial associated antigen antibody
    • S-endo 1 endothelial-associated antigen antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue sections labeling CD146 with ab203118 at a 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human cervical carcinoma tissue sections labeling CD146 with ab203118 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Wang X  et al. Influence of the intensity and loading time of direct current electric field on the directional migration of rat bone marrow mesenchymal stem cells. Front Med N/A:N/A (2016). Read more (PubMed: 27324024) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up