Overview

  • Product name

  • Description

    Rabbit polyclonal to CD147
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD147 aa 79-280. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    VHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWV RAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVL KEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKS SEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSS SQ


    Database link: P35613-1

  • Positive control

    • IHC-P: Human prostate cancer, kidney, glioma, stomach, stomach cancer, colorectal cancer tissue. ICC/IF: HeLa cells. WB: Recombinant human CD147 protein; HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
  • Tissue specificity

    Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Melanosome. Colocalizes with SLC16A1 and SLC16A8 (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5A11 antigen antibody
    • 5F7 antibody
    • BASI_HUMAN antibody
    • Basigin (Ok blood group) antibody
    • Basigin antibody
    • Blood brain barrier HT7 antigen antibody
    • Bsg antibody
    • CD 147 antibody
    • CD147 antibody
    • CD147 antigen antibody
    • Collagenase stimulatory factor antibody
    • EMMPRIN antibody
    • Extracellular matrix metalloproteinase inducer antibody
    • Leukocyte activation antigen M6 antibody
    • M 6 antibody
    • M6 antibody
    • M6 leukocyte activation antigen antibody
    • Neurothelin antibody
    • OK antibody
    • OK blood group antibody
    • OK blood group antigen antibody
    • TCSF antibody
    • Tumor cell derived collagenase stimulatory factor antibody
    • Tumor cell-derived collagenase stimulatory factor antibody
    see all

Images

  • Anti-CD147 antibody (ab232967) at 2 µg/ml + Recombinant human CD147 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labelling CD147 using ab232967 at 20 µg/ml in ICC/IF. FITC staining.

  • Anti-CD147 antibody (ab232967) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for CD147 using ab232967 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

References

ab232967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up