Anti-CD16 antibody (ab203883)

Rabbit polyclonal CD16 antibody. Validated in WB, IHC, Flow Cyt and tested in Mouse, Rat, Human. Cited in 3 publication(s). Immunogen corresponding to synthetic peptide.

Overview

  • Product name
  • Description
    Rabbit polyclonal to CD16
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD16 aa 145-195 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    GKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGL A


    Database link: P08637

  • Positive control
    • U937 cells; Human lung cancer, human glioma and mouse spleen tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 29 kDa.

Target

  • Function
    Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
  • Tissue specificity
    Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Glycosylated. Contains high mannose- and complex-type oligosaccharides.
    The soluble form is produced by a proteolytic cleavage.
  • Cellular localization
    Cell membrane. Secreted. Exists also as a soluble receptor.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 16 antibody
    • CD 16a antibody
    • CD16 antibody
    • CD16a antibody
    • CD16a antigen antibody
    • CD16B antibody
    • CD16b antigen antibody
    • Fc fragment of IgG antibody
    • Fc fragment of IgG low affinity IIIa receptor (CD16) antibody
    • Fc fragment of IgG low affinity IIIa receptor antibody
    • Fc fragment of IgG receptor IIIa antibody
    • Fc fragment of IgG, low affinity III, receptor (CD16) antibody
    • Fc fragment of IgG, low affinity III, receptor for (CD16) antibody
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16) antibody
    • Fc fragment of IgG, low affinity IIIa, receptor (CD16a) antibody
    • Fc fragment of IgG, low affinity IIIa, receptor for antibody
    • Fc fragment of IgG, low affinity IIIb, receptor (CD16b) antibody
    • Fc fragment of IgG, low affinity IIIb, receptor for (CD16) antibody
    • Fc gamma R3 antibody
    • Fc gamma receptor III 2 (CD 16) antibody
    • Fc gamma receptor III A antibody
    • Fc gamma receptor IIIA antibody
    • Fc gamma receptor IIIb (CD 16) antibody
    • Fc gamma RIII alpha antibody
    • Fc gamma RIII antibody
    • Fc gamma RIII beta antibody
    • Fc gamma RIIIa antibody
    • Fc gamma RIIIb antibody
    • Fc of IgG antibody
    • Fc-gamma receptor III2 (CD 16) antibody
    • Fc-gamma receptor III2 (CD16) antibody
    • Fc-gamma receptor IIIb (CD16) antibody
    • Fc-gamma RIII antibody
    • Fc-gamma RIII-alpha antibody
    • Fc-gamma RIIIa antibody
    • FCG 3 antibody
    • FCG3 antibody
    • FCG3A_HUMAN antibody
    • FCgammaRIIIA antibody
    • FCGR 3 antibody
    • FCGR 3A antibody
    • FCGR3 antibody
    • FCGR3A antibody
    • FCGR3A protein antibody
    • FCGRIII antibody
    • FCGRIII-2 antibody
    • FcR 10 antibody
    • FcR-10 antibody
    • FcR10 antibody
    • FcRIII antibody
    • FcRIIIa antibody
    • IGFR 3 antibody
    • IGFR3 antibody
    • IgG Fc receptor III 1 antibody
    • IgG Fc receptor III 2 antibody
    • IgG Fc receptor III-2 antibody
    • IMD20 antibody
    • immunoglobulin G Fc receptor III antibody
    • immunoglobulin G Fc receptor III-2 antibody
    • Low affinity IIIa receptor antibody
    • Low affinity immunoglobulin gamma Fc region receptor III A antibody
    • Low affinity immunoglobulin gamma Fc region receptor III-A antibody
    • Low affinity immunoglobulin gamma Fc region receptor IIIB antibody
    • neutrophil-specific antigen NA antibody
    see all

Images

  • All lanes : Anti-CD16 antibody (ab203883) at 1/300 dilution

    Lane 1 : Lung lysates
    Lane 2 : Spleen lysates

    Predicted band size: 29 kDa

  • U937 cells probed with ab203883 at a 1/100 for 40 minutes followed by incubation with Goat Anti-Rabbit IgG PE conjugated secondary at 1/100 (green) for 40 minutes compared to control cells (blue).

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human glioma tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung cancer tissue labeling CD16 with ab203883 at 1/200 dilution followed by Goat Anti-Rabbit IgG, Cy3 conjugated secondary antibody at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling CD16 with ab203883 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:
  • Akhmetzyanova ER  et al. Transplantation of Microglia in the Area of Spinal Cord Injury in an Acute Period Increases Tissue Sparing, but Not Functional Recovery. Front Cell Neurosci 12:507 (2018). Read more (PubMed: 30631265) »
  • Pasquier J  et al. Circulating microparticles in acute diabetic Charcot foot exhibit a high content of inflammatory cytokines, and support monocyte-to-osteoclast cell induction. Sci Rep 7:16450 (2017). Read more (PubMed: 29180664) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up