Overview

  • Product name

  • Description

    Rabbit polyclonal to CD160
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD160 aa 80-122 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    KRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIR


    Database link: O95971

  • Positive control

    • Rat kidney tissue lysates; Human cervical carcinoma and Rat brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab202845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200. Predicted molecular weight: 20 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Receptor showing broad specificity for both classical and non-classical MHC class I molecules.
  • Tissue specificity

    Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BY55 antibody
    • BY55_HUMAN antibody
    • CD160 antibody
    • CD160 antigen [Precursor] antibody
    • CD160 antigen antibody
    • CD160 delta Ig antibody
    • CD160 molecule antibody
    • CD160 transmembrane isoform antibody
    • FLJ46513 antibody
    • Natural killer cell receptor BY55 antibody
    • Natural killer cell receptor, immunoglobulin superfamily member antibody
    • NK1 antibody
    • NK28 antibody
    see all

Images

  • All lanes : Anti-CD160 antibody (ab202845) at 1/200 dilution

    Lane 1 : Rat brain tissue lysate
    Lane 2 : Rat kidney tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 20 kDa
    Observed band size: 27 kDa
    why is the actual band size different from the predicted?



    12% Gel.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human cervical carcinoma tissue labeling CD160 with ab202845 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling CD160 with ab202845 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab202845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up