Anti-CD161 antibody [4C6A11] (ab233785)
Key features and details
- Mouse monoclonal [4C6A11] to CD161
- Suitable for: Flow Cyt, WB
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-CD161 antibody [4C6A11]
See all CD161 primary antibodies -
Description
Mouse monoclonal [4C6A11] to CD161 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CD161 aa 67-225. (Expressed in E.coli).
Sequence:QKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWN NSLADCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWK WINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTP VRNKVYPDS
Database link: Q12918 -
Positive control
- WB: Recombinant human CD161 (AA: extra 67-225) protein and CD161 (AA: extra 67-225)-hIgGFc transfected HEK-293 whole cell lysate. Flow Cyt: Raji cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
4C6A11 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233785 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | 1/200 - 1/400. | |
WB | 1/500 - 1/2000. |
Target
-
Function
Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/RSK1 kinases stimulation as well as markedly enhanced T-cell proliferation induced by anti-CD3. Acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope as well as to the N-acetyllactosamine epitope. Binds also to CLEC2D/LLT1 as a ligand and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells. -
Tissue specificity
Expressed in a subset of NK cells predominantly in intestinal epithelium and liver. Detected in peripheral blood T-cells and preferentially in adult T-cells with a memory antigenic phenotype. -
Sequence similarities
Contains 1 C-type lectin domain. -
Post-translational
modificationsN-glycosylated. Contains sialic acid residues. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3820 Human
- Omim: 602890 Human
- SwissProt: Q12918 Human
- Unigene: 169824 Human
-
Alternative names
- C-type lectin domain family 5 member B antibody
- CD161 antibody
- CLEC5B antibody
see all
Images
-
Anti-CD161 antibody [4C6A11] (ab233785) at 1/500 dilution + Recombinant human CD161 (AA: extra 67-225) protein
Developed using the ECL technique.Expected MW is 48.4 kDa.
-
All lanes : Anti-CD161 antibody [4C6A11] (ab233785) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 2 : CD161 (AA: extra 67-225)-hIgGFc transfected HEK-293 whole cell lysate
Developed using the ECL technique. -
Flow cytometric analysis of Raji (human Burkitt's lymphoma cell line) cells labeling CD161 with ab233785 at 1/200 dilution (green) compared with a negative control (red).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233785 has not yet been referenced specifically in any publications.