Overview

  • Product name

  • Description

    Rabbit polyclonal to CD164
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse CD164 aa 24-162. N-terminal tag. Expressed in E. coli.
    Sequence:

    QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFT NNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTA KPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD


    Database link: Q9R0L9

  • Positive control

    • WB: Recombinant mouse CD164 protein; mouse testis tissue lysate. IHC-P: Mouse kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 21 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    CD164 is a member of the CD164 family of proteins and is highly N- and O-glycosylated. It has a Ser-Gly motif that may serve as the site of attachment of a glycosaminoglycan side chain. It contains sialic acid. CD164 may be associated with carcinoma and is probably a mucin.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • CD164 antigen antibody
    • CD164 antigen, sialomucin antibody
    • CD164 molecule, sialomucin antibody
    • endolyn antibody
    • ESM antibody
    • MGC 24 antibody
    • MUC 24 antibody
    • Multi glycosylated core protein 24 antibody
    • Putative mucin core protein 24 precursor antibody
    • Putative mucin core protein precursor 24 antibody
    • RP11-425D10.9 antibody
    • sialomucin antibody
    • Sialomucin CD164 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for CD164 with ab231131 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD164 antibody (ab231131) at 2 µg/ml + Mouse testis tissue lysate

    Secondary
    Goat anti-rabbit IgG HRP at 0.2 µg/ml

    Predicted band size: 21 kDa

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for CD164 with ab231131 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD164 antibody (ab231131) at 2 µg/ml + Recombinant mouse CD164 protein

    Predicted band size: 21 kDa

References

ab231131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up