Anti-CD164 antibody (ab231134)
Key features and details
- Rabbit polyclonal to CD164
- Suitable for: IHC-P, WB
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-CD164 antibody
See all CD164 primary antibodies -
Description
Rabbit polyclonal to CD164 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat CD164 aa 24-160. Expressed in E.coli. N-terminal tags. Extracellular domain.
Sequence:QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTN NITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKP TTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD
Database link: Q9QX82 -
Positive control
- WB: Recombinant rat CD164 protein; rat testis lysate and serum. IHC-P: Rat kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231134 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Relevance
CD164 is a member of the CD164 family of proteins and is highly N- and O-glycosylated. It has a Ser-Gly motif that may serve as the site of attachment of a glycosaminoglycan side chain. It contains sialic acid. CD164 may be associated with carcinoma and is probably a mucin. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 83689 Rat
- SwissProt: Q9QX82 Rat
- Unigene: 3733 Rat
-
Alternative names
- CD164 antigen antibody
- CD164 antigen, sialomucin antibody
- CD164 molecule, sialomucin antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD164 antibody (ab231134)Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD164 with ab231134 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-CD164 antibody (ab231134)Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat serum
Predicted band size: 20 kDa -
Western blot - Anti-CD164 antibody (ab231134)Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat testis tissue lysate
Predicted band size: 20 kDa -
Western blot - Anti-CD164 antibody (ab231134)Anti-CD164 antibody (ab231134) at 1 µg/ml + Recombinant rat CD164 protein
Predicted band size: 20 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231134 has not yet been referenced specifically in any publications.
