Anti-CD164 antibody (ab231134)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CD164 antibody
See all CD164 primary antibodies -
Description
Rabbit polyclonal to CD164 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat CD164 aa 24-160. Expressed in E.coli. N-terminal tags. Extracellular domain.
Sequence:QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTN NITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKP TTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD
Database link: Q9QX82 -
Positive control
- WB: Recombinant rat CD164 protein; rat testis lysate and serum. IHC-P: Rat kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231134 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Relevance
CD164 is a member of the CD164 family of proteins and is highly N- and O-glycosylated. It has a Ser-Gly motif that may serve as the site of attachment of a glycosaminoglycan side chain. It contains sialic acid. CD164 may be associated with carcinoma and is probably a mucin. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 83689 Rat
- SwissProt: Q9QX82 Rat
- Unigene: 3733 Rat
-
Alternative names
- CD164 antigen antibody
- CD164 antigen, sialomucin antibody
- CD164 molecule, sialomucin antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD164 antibody (ab231134)
Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD164 with ab231134 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat serum
Predicted band size: 20 kDa -
Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat testis tissue lysate
Predicted band size: 20 kDa -
Anti-CD164 antibody (ab231134) at 1 µg/ml + Recombinant rat CD164 protein
Predicted band size: 20 kDa
Datasheets and documents
References
ab231134 has not yet been referenced specifically in any publications.