Overview

  • Product name

  • Description

    Rabbit polyclonal to CD164
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat CD164 aa 24-160. Expressed in E.coli. N-terminal tags. Extracellular domain.
    Sequence:

    QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTN NITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKP TTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD


    Database link: Q9QX82

  • Positive control

    • WB: Recombinant rat CD164 protein; rat testis lysate and serum. IHC-P: Rat kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Relevance

    CD164 is a member of the CD164 family of proteins and is highly N- and O-glycosylated. It has a Ser-Gly motif that may serve as the site of attachment of a glycosaminoglycan side chain. It contains sialic acid. CD164 may be associated with carcinoma and is probably a mucin.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • CD164 antigen antibody
    • CD164 antigen, sialomucin antibody
    • CD164 molecule, sialomucin antibody
    • endolyn antibody
    • ESM antibody
    • MGC 24 antibody
    • MUC 24 antibody
    • Multi glycosylated core protein 24 antibody
    • Putative mucin core protein 24 precursor antibody
    • Putative mucin core protein precursor 24 antibody
    • RP11-425D10.9 antibody
    • sialomucin antibody
    • Sialomucin CD164 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for CD164 with ab231134 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat serum

    Predicted band size: 20 kDa

  • Anti-CD164 antibody (ab231134) at 1 µg/ml + Rat testis tissue lysate

    Predicted band size: 20 kDa

  • Anti-CD164 antibody (ab231134) at 1 µg/ml + Recombinant rat CD164 protein

    Predicted band size: 20 kDa

References

ab231134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up