Overview

  • Product name

  • Description

    Rabbit polyclonal to CD177
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD177 aa 24-118.
    Sequence:

    CQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLS KGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLP


    Database link: Q8N6Q3

  • Positive control

    • Human bone marrow tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Highly expressed in normal bone marrow and weakly expressed in fetal liver. Expressed on neutrophils. Expressed in granulocytes of patients with polycythemia vera (PV) and with essential thrombocythemia (ET).
  • Sequence similarities

    Contains 2 UPAR/Ly6 domains.
  • Post-translational
    modifications

    N-glycosylated.
    A soluble form may also be produced by proteolytic cleavage at the cell surface (shedding).
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD177 antibody
    • CD177 antigen antibody
    • CD177 molecule antibody
    • CD177_HUMAN antibody
    • HNA-2a antibody
    • HNA2A antibody
    • Human neutrophil alloantigen 2a antibody
    • NB1 antibody
    • NB1 glycoprotein antibody
    • NB1 GP antibody
    • Polycythemia rubra vera 1 antibody
    • Polycythemia rubra vera protein 1 antibody
    • PRV-1 antibody
    • PRV1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human bone marrow tissue labeling CD177 with ab220281 at 1/50 dilution.

References

ab220281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up