Overview

  • Product name

    Anti-CD19 (phospho Y531) antibody
    See all CD19 primary antibodies
  • Description

    Rabbit polyclonal to CD19 (phospho Y531)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human CD19 aa 505-555 (phospho Y531) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWS TR


    Database link: P15391

  • Positive control

    • Human esophageal cancer tissue; Mouse fetal liver and spleen tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
  • Involvement in disease

    Defects in CD19 are the cause of immunodeficiency common variable type 3 (CVID3) [MIM:613493]; also called antibody deficiency due to CD19 defect. CVID3 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine upon DNA damage, probably by ATM or ATR. Phosphorylated on tyrosine following B-cell activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antibody deficiency due to defect in CD19 antibody
    • Antibody deficiency due to defect in CD19, included antibody
    • AW495831 antibody
    • B lymphocyte antigen CD19 antibody
    • B lymphocyte surface antigen B4 antibody
    • B-lymphocyte antigen CD19 antibody
    • B-lymphocyte surface antigen B4 antibody
    • B4 antibody
    • CD19 antibody
    • CD19 antigen antibody
    • CD19 molecule antibody
    • Cd19 protein antibody
    • CD19_HUMAN antibody
    • CVID3 antibody
    • Differentiation antigen CD19 antibody
    • Leu 12 antibody
    • Leu-12 antibody
    • Leu12 antibody
    • MGC109570 antibody
    • MGC12802 antibody
    • T-cell surface antigen Leu-12 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human esophageal cancer tissue labeling CD19 (phospho Y531) with ab203615 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded mouse fetal liver tissue labeling CD19 (phospho Y531) with ab203615 at 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6) for 15min; Block endogenous peroxidase by 3% hydrogen peroxide for 30 minutes; Blocking buffer (normal goat serum) at 37°C for 20min.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded mouse spleen tissue labeling CD19 (phospho Y531) with ab203615 at 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6) for 15min; Block endogenous peroxidase by 3% hydrogen peroxide for 30 minutes; Blocking buffer (normal goat serum) at 37°C for 20min.

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded mouse spleen tissue labeling CD19 (phospho Y531) with ab203615 at 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

    Antigen retrieval by boiling in sodium citrate buffer (pH6) for 15min; Block endogenous peroxidase by 3% hydrogen peroxide for 30 minutes; Blocking buffer (normal goat serum) at 37°C for 20min.

References

This product has been referenced in:

  • Kiss MG  et al. Complement Factor H Modulates Splenic B Cell Development and Limits Autoantibody Production. Front Immunol 10:1607 (2019). Read more (PubMed: 31354740) »
  • Waterborg CEJ  et al. Tyro3/Axl/Mertk-deficient mice develop bone marrow edema which is an early pathological marker in rheumatoid arthritis. PLoS One 13:e0205902 (2018). Read more (PubMed: 30335822) »
See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse spleen and lung (multiblock))
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Dako high pH buffer
Permeabilization
No
Specification
Mouse spleen and lung (multiblock)
Blocking step
Vector Casein solution as blocking agent for 30 minute(s) · Concentration: 10µg/mL
Fixative
Paraformaldehyde

Dr. Henry King

Verified customer

Submitted Aug 11 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up