Overview

  • Product name

  • Description

    Rabbit polyclonal to CD1b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD1b aa 18-303.
    Sequence:

    SEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIF LKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGI AGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALII QYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGP GRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATL DVADGEAAGLSCRVKHSSLEGQDIILYWRNPTSIGS


    Database link: P29016

  • Positive control

    • IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
  • Tissue specificity

    Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane. Endosome membrane. Lysosome membrane. Subject to intracellular trafficking between the cell membrane, endosomes and lysosomes. Localizes to cell surface lipid rafts.
  • Information by UniProt
  • Database links

  • Alternative names

    • A1 domain antibody
    • CD1 antibody
    • CD1A antibody
    • CD1b antibody
    • CD1b antigen antibody
    • CD1B antigen b polypeptide antibody
    • CD1b molecule antibody
    • CD1B_HUMAN antibody
    • Cortical thymocyte antigen CD1A antibody
    • Cortical thymocyte antigen CD1B antibody
    • Differentiation antigen CD1 alpha 3 antibody
    • hTa1 thymocyte antigen antibody
    • Ly38 antibody
    • Ly38; T cell surface glycoprotein CD1a antibody
    • MGC125990 antibody
    • MGC125991 antibody
    • R1 antibody
    • T-cell surface glycoprotein CD1b antibody
    • T6/Leu6 antibody
    • Thymocite antigen CD1B antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for CD1b using ab223122 at 1/100 dilution in immunohistochemical analysis.

References

ab223122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up