Anti-CD20 antibody [IGEL/773] - BSA and Azide free (ab213033)

Overview

  • Product name

    Anti-CD20 antibody [IGEL/773] - BSA and Azide free
    See all CD20 primary antibodies
  • Description

    Mouse monoclonal [IGEL/773] to CD20 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD20 aa 1-297.
    Sequence:

    MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL LAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKME SLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF AFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLT ETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP


    Database link: P11836

  • Positive control

    • Human tonsil and lymphoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab213033 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    This protein may be involved in the regulation of B-cell activation and proliferation.
  • Tissue specificity

    Expressed on B-cells.
  • Involvement in disease

    Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5) [MIM:613495]; also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Belongs to the MS4A family.
  • Post-translational
    modifications

    Phosphorylated. Might be functionally regulated by protein kinase(s).
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • APY antibody
    • ATOPY antibody
    • B lymphocyte antigen CD20 antibody
    • B Lymphocyte Cell Surface Antigen B1 antibody
    • B-lymphocyte antigen CD20 antibody
    • B-lymphocyte cell-surface antigen B1 antibody
    • B-lymphocyte surface antigen B1 antibody
    • B1 antibody
    • Bp 35 antibody
    • Bp35 antibody
    • CD 20 antibody
    • CD20 antibody
    • CD20 antigen antibody
    • CD20 receptor antibody
    • CD20_HUMAN antibody
    • CVID 5 antibody
    • CVID5 antibody
    • Fc epsilon receptor I beta chain antibody
    • Fc Fragment of IgE high affinity I receptor for beta polypeptide antibody
    • FCER1B antibody
    • High affinity immunoglobulin epsilon receptor subunit beta antibody
    • IgE Fc receptor subunit beta antibody
    • IGEL antibody
    • IGER antibody
    • IGHER antibody
    • LEU 16 antibody
    • Leu-16 antibody
    • LEU16 antibody
    • leukocyte surface antigen Leu 16 antibody
    • Leukocyte surface antigen Leu-16 antibody
    • Ly44 antibody
    • Membrane spanning 4 domains A1 antibody
    • Membrane spanning 4 domains subfamily A member 2 antibody
    • membrane-spanning 4-domains A1 antibody
    • Membrane-spanning 4-domains subfamily A member 1 antibody
    • MGC3969 antibody
    • MS4A1 antibody
    • MS4A2 antibody
    • S7 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling CD20 with ab213033 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lymphoma tissue labeling CD20 with ab213033 at 1 µg/ml.

References

ab213033 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213033.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up