Anti-CD200 / OX2 antibody [6E8B11] (ab201984)
Key features and details
- Mouse monoclonal [6E8B11] to CD200 / OX2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CD200 / OX2 antibody [6E8B11]
See all CD200 / OX2 primary antibodies -
Description
Mouse monoclonal [6E8B11] to CD200 / OX2 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human CD200/ OX2 aa 56-257.
Sequence:AQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNST ITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDH LNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPK NQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI LL
Database link: P41217 -
Positive control
- Human CD200 / OX2 (aa56-257) recombinant protein; CD200 / OX2 (aa56-257)-hIgGFc transfected HEK293 cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6E8B11 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab201984 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 31 kDa. |
Target
-
Function
Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues. -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4345 Human
- Entrez Gene: 100172623 Orangutan
- Omim: 155970 Human
- SwissProt: P41217 Human
- SwissProt: Q5RAL8 Orangutan
- Unigene: 79015 Human
-
Alternative names
- Antigen identified by monoclonal antibody MRC OX 2 antibody
- CD200 antibody
- CD200 antigen antibody
see all
Images
-
Anti-CD200 / OX2 antibody [6E8B11] (ab201984) at 1/500 dilution + Human CD200 / OX2 (aa56-257) recombinant protein
Predicted band size: 31 kDaExpected MWt is 48.4 kDa.
-
All lanes : Anti-CD200 / OX2 antibody [6E8B11] (ab201984) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : CD200 / OX2 (aa56-257)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 31 kDa
Datasheets and documents
References (0)
ab201984 has not yet been referenced specifically in any publications.