Overview

  • Product name

    Anti-CD200 / OX2 antibody [6E8B11]
    See all CD200 / OX2 primary antibodies
  • Description

    Mouse monoclonal [6E8B11] to CD200 / OX2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CD200/ OX2 aa 56-257.
    Sequence:

    AQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNST ITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDH LNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPK NQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI LL


    Database link: P41217

  • Positive control

    • Human CD200 / OX2 (aa56-257) recombinant protein; CD200 / OX2 (aa56-257)-hIgGFc transfected HEK293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab201984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 31 kDa.

Target

  • Function

    Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen identified by monoclonal antibody MRC OX 2 antibody
    • CD200 antibody
    • CD200 antigen antibody
    • CD200 molecule antibody
    • MOX1 antibody
    • MOX2 antibody
    • MRC antibody
    • MRC OX 2 antigen antibody
    • My033 antibody
    • OX 2 antibody
    • OX 2 membrane glycoprotein precursor antibody
    • OX-2 membrane glycoprotein antibody
    • OX2G antibody
    • OX2G_HUMAN antibody
    see all

Images

  • Anti-CD200 / OX2 antibody [6E8B11] (ab201984) at 1/500 dilution + Human CD200 / OX2 (aa56-257) recombinant protein

    Predicted band size: 31 kDa



    Expected MWt is 48.4 kDa.

  • All lanes : Anti-CD200 / OX2 antibody [6E8B11] (ab201984) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : CD200 / OX2 (aa56-257)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 31 kDa

References

ab201984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up