Overview

  • Product name

  • Description

    Rabbit polyclonal to CD200 / OX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
    Unsuitable for: Flow Cyt
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD200/ OX2 aa 45-95 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    TPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKI N


    Database link: P41217

  • Positive control

    • Human lung carcinoma tissue; Human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50-1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 31 kDa.
  • Application notes
    Is unsuitable for Flow Cyt.
  • Target

    Images

    • Immunohistochemistry analysis of Formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling CD200 / OX2 with ab203887 at 1/200 dilution.

    • Immunohistochemistry analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling CD200 / OX2 with ab203887 at 1/200 dilution.

    References

    This product has been referenced in:

    • Akhmetzyanova ER  et al. Transplantation of Microglia in the Area of Spinal Cord Injury in an Acute Period Increases Tissue Sparing, but Not Functional Recovery. Front Cell Neurosci 12:507 (2018). Read more (PubMed: 30631265) »
    • Debnath S  et al. Discovery of a periosteal stem cell mediating intramembranous bone formation. Nature 562:133-139 (2018). Read more (PubMed: 30250253) »
    See all 2 Publications for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab203887.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up