Overview

  • Product name

    Anti-CD21 antibody - C-terminal
    See all CD21 primary antibodies
  • Description

    Rabbit polyclonal to CD21 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CD21 aa 1050-1092 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    IVITLYVISKHRARNYYTDTSQKEAFHLEAREVYSVDPYNPAS


    Database link: P20023-3

  • Positive control

    • Mouse splenocyte cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20 - 1/100.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

WB 1/100 - 1/1000. Predicted molecular weight: 119 kDa.

Target

  • Function

    Receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRPU. Participates in B lymphocytes activation.
  • Tissue specificity

    Mature B-lymphocytes, T-lymphocytes, pharyngeal epithelial cells, astrocytes and follicular dendritic cells of the spleen.
  • Involvement in disease

    Genetic variations in CR2 are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9) [MIM:610927]. Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities

    Belongs to the receptors of complement activation (RCA) family.
    Contains 15 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C3DR antibody
    • CD 21 antibody
    • CD21 antibody
    • Complement C3d receptor 2 antibody
    • Complement C3d receptor antibody
    • Complement component (3d/Epstein Barr virus) receptor 2 antibody
    • Complement receptor type 2 antibody
    • CR antibody
    • Cr2 antibody
    • CR2_HUMAN antibody
    • CVID7 antibody
    • EBV receptor antibody
    • EBV-R antibody
    • Epstein Barr virus receptor antibody
    • Epstein-Barr virus receptor antibody
    • EVBR antibody
    • SLEB9 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human lung carcinoma labeling CD21b/c with ab203299 at a 1/200 dilution,followed by conjugation to the secondary antibody and DAB staining.

  • Flow cytometric analysis of Mouse splenocytes labeling CD21 with ab203299 at 1/100 dilution (green) or a rabbit IgG negative (blue).

References

ab203299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up