Overview

  • Product name

    Anti-CD22 antibody [2H1C4]
    See all CD22 primary antibodies
  • Description

    Mouse monoclonal [2H1C4] to CD22
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, ICC/IF, Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CD22 aa 621-725. expressed in E. Coli.
    Sequence:

    NPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRS PLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENS


    Database link: P20273

  • Positive control

    • Human CD22 recombinant protein; HEK293 cell lysate, transfected with CD22 (amino acids 622-725); Mouse L1210, HeLa, HEK293, Jurkat, OCM-1, A432 and mouse NIH 3T3 cell lysates; HeLa cells; Human cervical cancer and cerebellum tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab181771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 95 kDa.

Target

  • Function

    Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
  • Tissue specificity

    B-lymphocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-762, Tyr-807 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2.
    Phosphorylated on tyrosine residues by LYN.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell receptor CD22 precursor antibody
    • B lymphocyte cell adhesion molecule antibody
    • B-cell receptor CD22 antibody
    • B-lymphocyte cell adhesion molecule antibody
    • BL CAM antibody
    • BL-CAM antibody
    • BLCAM antibody
    • CD 22 antibody
    • CD22 antibody
    • CD22 antigen antibody
    • CD22 molecule antibody
    • CD22 protein antibody
    • CD22_HUMAN antibody
    • Lectin 2 antibody
    • Leu14 antibody
    • Lyb8 antibody
    • MGC130020 antibody
    • sialic acid binding Ig like lectin 2 antibody
    • Sialic acid binding immunoglobulin like lectin 2 antibody
    • Sialic acid-binding Ig-like lectin 2 antibody
    • SIGLEC 2 antibody
    • Siglec-2 antibody
    • SIGLEC2 antibody
    • T cell surface antigen Leu 14 antibody
    • T-cell surface antigen Leu-14 antibody
    see all

Images

  • Flow cytometric analysis of HeLa cells labeling CD22 with ab181771 at 1/200 dilution (green); negative control (red).

  • Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution + Human CD22 recombinant protein

    Predicted band size: 95 kDa

  • All lanes : Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with CD22 (amino acids 622-725)-hIgGFc

    Predicted band size: 95 kDa

  • All lanes : Anti-CD22 antibody [2H1C4] (ab181771) at 1/500 dilution

    Lane 1 : mouse L1210 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : HEK293 cell lysate
    Lane 4 : Jurkat cell lysate
    Lane 5 : OCM-1 cell lysate
    Lane 6 : A432 cell lysate
    Lane 7 : mouse NIH 3T3 cell lysate

    Predicted band size: 95 kDa

  • Immunofluorescent analysis of HeLa cells, labeling CD22 with ab181771 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling CD22 with ab181771 at 1/200 dilution followed by DAB staining.

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling CD22 with ab181771 at 1/200 dilution followed by DAB staining.

References

ab181771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up