Anti-CD229 antibody (ab231915)
Key features and details
- Rabbit polyclonal to CD229
- Suitable for: WB, IHC-P
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-CD229 antibody
See all CD229 primary antibodies -
Description
Rabbit polyclonal to CD229 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment (His-tag) corresponding to Mouse CD229 aa 384-642. N-terminal tag, expressed in E.coli
Sequence:VDGGGNNVTYTWMPLQNKAVMSQGKSHLNVSWESGEHLPNFTCTAHNPVS NSSSQFSSGTICSGPERNKRFWLLLLLVLLLLMLIGGYFILRKKKQCSSL ATRYRQAEVPAEIPETPTGHGQFSVLSQRYEKLDMSAKTTRHQPTPTSDT SSESSATTEEDDEKTRMHSTANSRNQVYDLVTHQDIAHALAYEGQVEYEA ITPYDKVDGSMDEEDMAYIQVSLNVQGETPLPQKKEDSNTIYCSVQKPKK TAQTPQQDA
Database link: Q01965 -
Positive control
- IHC-P: Mouse small intestine and kidney tissue. WB: Recombinant mouse CD229 protein; Mouse lymphocyte lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231915 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 2 Ig-like V-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 17085 Mouse
- SwissProt: Q01965 Mouse
- Unigene: 560 Mouse
-
Alternative names
- CD229 antibody
- Cell surface molecule Ly-9 antibody
- Cell surface molecule Ly9 antibody
see all
Images
-
Anti-CD229 antibody (ab231915) at 1 µg/ml + Mouse lymphocyte lysate.
Developed using the ECL technique. -
Anti-CD229 antibody (ab231915) at 1 µg/ml + Recombinant mouse CD229 protein.
Developed using the ECL technique. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD229 antibody (ab231915)
Formalin-fixed, paraffin-embedded mouse kidney tissue stained for CD229 using ab231915 at 20 µg/mL in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CD229 antibody (ab231915)
Formalin-fixed, paraffin-embedded mouse small intestine tissue stained for CD229 using ab231915 at 20 µg/mL in immunohistochemical analysis. AEC staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231915 has not yet been referenced specifically in any publications.