Overview

  • Product name

  • Description

    Rabbit polyclonal to CD239/BCAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD239/BCAM aa 312-445.
    Sequence:

    EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYL DPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSL SSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ


    Database link: P50895

  • Positive control

    • IHC-P: Human urinary bladder tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as CD239

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Laminin alpha-5 receptor. May mediate intracellular signaling.
  • Tissue specificity

    Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Developmental stage

    Is under developmental control in liver and may also be regulated during differentiation in other tissues. Up-regulated following malignant transformation in some cell types.
  • Post-translational
    modifications

    Epinephrine-stimulated phosphorylation of Ser-621 by PKA enhances adhesion to laminin.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen identified by monoclonal antibody F8 antibody
    • AU antibody
    • Auberger B antigen antibody
    • B CAM cell surface glycoprotein antibody
    • B cell adhesion molecule antibody
    • B-CAM cell surface glycoprotein antibody
    • Basal cell adhesion molecule (Lu and Au blood groups) antibody
    • Basal cell adhesion molecule (Lutheran blood group) antibody
    • Basal cell adhesion molecule antibody
    • Basal cell adhesion molecule Lu and Au blood groups antibody
    • Basal cell adhesion molecule Lutheran blood group antibody
    • Bcam antibody
    • BCAM_HUMAN antibody
    • CD239 antibody
    • CD239 antigen antibody
    • F8/G253 antigen antibody
    • Glycoprotein 95kDa antibody
    • LU antibody
    • Lutheran antibody
    • Lutheran antigen antibody
    • Lutheran blood group (Auberger b antigen included) antibody
    • Lutheran blood group Auberger b antigen included antibody
    • Lutheran blood group glycoprotein antibody
    • MSK19 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human urinary bladder tissue stained for CD239/BCAM using ab244280 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for CD239/BCAM (green) using ab244280 at 4 µg/ml in ICC/IF.

References

ab244280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up