Overview

  • Product name

  • Description

    Rabbit polyclonal to CD24
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD24 aa 30-80.
    Sequence:

    TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLY S


    Database link: P25063

  • Positive control

    • ICC/IF: RT4 cell lysate.

Applications

Our Abpromise guarantee covers the use of ab244478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.
  • Tissue specificity

    B-cells. Expressed in a number of B-cell lines including P32/SH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
  • Involvement in disease

    Genetic variations in CD24 are associated with susceptibility to multiple sclerosis (MS) [MIM:126200]. A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. Note=Polymorphisms in CD24 may act as a genetic modifier for susceptibility and progression of MS in some populations, perhaps by affecting the efficiency of CD24 expression on the cell surface.
  • Sequence similarities

    Belongs to the CD24 family.
  • Post-translational
    modifications

    Extensively O-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 24 antibody
    • CD24 antibody
    • CD24 antigen (small cell lung carcinoma cluster 4 antigen) antibody
    • CD24 antigen antibody
    • CD24 molecule antibody
    • CD24_HUMAN antibody
    • CD24A antibody
    • FLJ22950 antibody
    • FLJ43543 antibody
    • GPI linked surface mucin antibody
    • Heat stable antigen antibody
    • HSA antibody
    • MGC75043 antibody
    • Nectadrin antibody
    • Signal transducer CD24 antibody
    • Small cell lung carcinoma cluster 4 antigen antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for CD24 (green) using ab244478 at 4 μg/ml in ICC/IF.

References

ab244478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up