Overview

  • Product name

    Anti-CD272/BTLA antibody [4B12A7]
    See all CD272/BTLA primary antibodies
  • Description

    Mouse monoclonal [4B12A7] to CD272/BTLA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD272/BTLA aa 179-289. Cytoplasmic domain. Expressed in E.coli.
    Sequence:

    RRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDN DPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEA PTEYASICVRS


    Database link: Q7Z6A9

  • Positive control

    • WB: Recombinant human CD272/BTLA (aa 179-289) protein; CD272/BTLA (aa 179-289)-hIgG-Fc-transfected HEK-293 cell lysate. Flow cyt: HL-60 cells.
  • General notes

     This product was previously labelled as CD272

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    4B12A7
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11.
    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B and T lymphocyte associated protein antibody
    • B and T lymphocyte attenuator antibody
    • B and T lymphocyte associated antibody
    • B- and T-lymphocyte attenuator antibody
    • B- and T-lymphocyte-associated protein antibody
    • BTLA antibody
    • BTLA_HUMAN antibody
    • BTLA1 antibody
    • CD272 antibody
    • CD272 antigen antibody
    • FLJ16065 antibody
    • MGC129743 antibody
    see all

Images

  • Anti-CD272/BTLA antibody [4B12A7] (ab233809) at 1/500 dilution + Recombniant human CD272/BTLA (aa 179-289) protein


    Expected recombinant MW is 38 kDa.

  • All lanes : Anti-CD272/BTLA antibody [4B12A7] (ab233809) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : CD272/BTLA (aa 179-289)-hIgG-Fc-transfected HEK-293 cell lysate
  • Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling CD272/BTLA with ab233809 at 1/200 dilution (green) compared with a negative control (red).

References

ab233809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up