Overview

  • Product name

  • Description

    Rabbit polyclonal to CD276
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human CD276 aa 47-219. N-terminal tag. Expressed in E. coli.
    Sequence:

    TLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALF PDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPS MTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMA NEQGLFDVHSILRVVLGANGTYS


    Database link: Q5ZPR3

  • Positive control

    • WB: Recombinant human CD276 protein. HEK-293T, MCF7 and PC-3 cell lysate. IHC-P: Human liver cancer, prostate and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.
  • Tissue specificity

    Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in extravillous trophoblast cells and Hofbauer cells of the first trimester placenta and term placenta.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4Ig B7 H3 antibody
    • 4Ig-B7-H3 antibody
    • AU016588 antibody
    • B7 H3 antibody
    • B7 homolog 3 antibody
    • B7-H3 antibody
    • B7H3 antibody
    • B7RP-2 antibody
    • CD_antigen=CD276 antibody
    • CD276 antibody
    • CD276 antigen antibody
    • CD276 molecule antibody
    • CD276_HUMAN antibody
    • Costimulatory molecule antibody
    • Flags: Precursor antibody
    • PSEC0249 antibody
    • UNQ309/PRO352 antibody
    see all

Images

  • All lanes : Anti-CD276 antibody (ab232791) at 3 µg/ml

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PC-3 (Human prostate adenocarcinoma cell line) cell lysate
    Lane 3 : MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human prostate tissue stained for CD276 with ab232791 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD276 with ab232791 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CD276 with ab232791 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD276 antibody (ab232791) at 3 µg/ml + Recombinant human CD276 protein.

References

ab232791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up