Overview

  • Product name

  • Description

    Rabbit polyclonal to CD2AP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat CD2AP aa 368-623. (Expressed in E.coli).
    Sequence:

    DRDEKSLLEQKPSKPAAPQVPPKKPTPPTKANNLLRSPGTMYPKRPEKPV PPPPPTAKINGEVSTISSKIDTEPLSKPKLDPEQLPVRPKSVDLDALVAR NSKETDNVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTQSPEK TLKLPKDDDSGNIKPSEFKKDAGYSSKPSLSAPSSASKVNTAAFLSPLEL KAKVEADDGTKSSLDELRAQITELLCIVDALKKDHGKELEKLRRELEEEK AMRSNL


    Database link: F1LRS8

  • Positive control

    • IHC-P: Rat testis, stomach, liver, kidney, brain and spleen tissues. WB: Rat testis, liver and cerebrum lysates; Recombinant rat CD2AP protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 70 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Seems to act as an adapter protein between membrane proteins and the actin cytoskeleton. May play a role in receptor clustering and cytoskeletal polarity in the junction between T-cell and antigen-presenting cell. May anchor the podocyte slit diaphragm to the actin cytoskeleton in renal glomerolus. Also required for cytokinesis.
  • Tissue specificity

    Widely expressed in fetal and adult tissues.
  • Involvement in disease

    Defects in CD2AP are the cause of susceptibility to focal segmental glomerulosclerosis type 3 (FSGS3) [MIM:607832]. A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities

    Contains 3 SH3 domains.
  • Domain

    The Pro-rich domain may mediate binding to SH3 domains.
    Potential homodimerization is mediated by the coiled coil domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues; probably by c-Abl, Fyn and c-Src.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > ruffle. Colocalizes with F-actin and BCAR1/p130Cas in membrane ruffles. Located at podocyte slit diaphragm between podocyte foot processes (By similarity). During late anaphase and telophase, concentrates in the vicinity of the midzone microtubules and in the midbody in late telophase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapter protein CMS antibody
    • AL024079 antibody
    • C78928 antibody
    • Cas ligand with multiple SH3 domains antibody
    • CD2 associated protein antibody
    • CD2-associated protein antibody
    • CD2AP antibody
    • CD2AP_HUMAN antibody
    • CMS antibody
    • Mesenchyme to epithelium transition protein with SH3 domains 1 antibody
    • METS 1 antibody
    • Mets1 antibody
    see all

Images

  • Paraffin-embedded rat testis tissue stained for CD2AP using ab231320 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for CD2AP using ab231320 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat liver tissue stained for CD2AP using ab231320 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for CD2AP using ab231320 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat brain tissue stained for CD2AP using ab231320 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat spleen tissue stained for CD2AP using ab231320 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD2AP antibody (ab231320) at 2 µg/ml + Recombinant rat CD2AP protein.

    Predicted band size: 70 kDa

  • Anti-CD2AP antibody (ab231320) at 1 µg/ml + Rat testis lysate

    Predicted band size: 70 kDa

  • Anti-CD2AP antibody (ab231320) at 1 µg/ml + Rat liver lysate

    Predicted band size: 70 kDa

  • Anti-CD2AP antibody (ab231320) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 70 kDa

References

ab231320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up