Overview

  • Product name

  • Description

    Rabbit polyclonal to CD3 zeta
  • Host species

    Rabbit
  • Specificity

    ab190728 detects endogenous levels of CD3 zeta protein.
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CD3 zeta aa 1-164.
    Sequence:

    MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALF LRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR


    Database link: P20963

  • Positive control

    • Extracts of Jurkat cell line.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab190728 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen, and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 19 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probable role in assembly and expression of the TCR complex as well as signal transduction upon antigen triggering.
  • Involvement in disease

    Defects in CD247 are the cause of immunodeficiency due to defect in CD3-zeta (CD3ZID) [MIM:610163]. An immunological deficiency characterized by T-cells impaired immune response to alloantigens, tetanus toxoid and mitogens.
  • Sequence similarities

    Belongs to the CD3Z/FCER1G family.
    Contains 3 ITAM domains.
  • Domain

    The ITAM domains mediate interaction with SHB.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues after T-cell receptor triggering.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4930549J05Rik antibody
    • A430104F18Rik antibody
    • AW552088 antibody
    • CD247 antibody
    • CD247 antigen antibody
    • Cd247 molecule antibody
    • Cd3 antibody
    • CD3 antigen, zeta polypeptide, isoform CRA_b antibody
    • CD3 antigen, zeta subunit antibody
    • CD3-eta antibody
    • CD3H antibody
    • CD3Q antibody
    • Cd3z antibody
    • CD3Z antigen zeta polypeptide (TiT3 complex) antibody
    • CD3Z_HUMAN antibody
    • CD3zeta antibody
    • CD3zeta chain antibody
    • MGC140430 antibody
    • T cell receptor T3 zeta chain antibody
    • T cell surface glycoprotein CD3 zeta chain antibody
    • T-cell antigen receptor complex, zeta subunit of CD3 antibody
    • T-cell receptor T3 zeta chain antibody
    • T-cell surface glycoprotein CD3 zeta chain antibody
    • T3z antibody
    • TCR zeta chain antibody
    • TCRk antibody
    • TCRZ antibody
    • TCRzeta antibody
    see all

Images

  • Immunofluorescence analysis of A549 cells, using CD3 Zeta polyclonal antibody at 1:50.

  • Anti-CD3 zeta antibody (ab190728) + extracts of Jurkat cell line

    Predicted band size: 19 kDa

References

This product has been referenced in:

  • Bustos-Morán E  et al. Microtubule-associated protein-4 controls nanovesicle dynamics and T cell activation. J Cell Sci 130:1217-1223 (2017). Read more (PubMed: 28209780) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up