Overview

  • Product name

  • Description

    Mouse polyclonal to CD30-L
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CD30-L aa 1-234.
    Sequence:

    MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCL VFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWA YLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQ CPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQV NTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD


    Database link: NP_001235.1

  • Positive control

    • CD30-L-transfected 293T cell lysate.
  • General notes

    Previously labelled as CD153. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab171779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Function

    Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD153 antibody
    • CD153 antigen antibody
    • CD30 antigen ligand antibody
    • CD30 L antibody
    • CD30 ligand antibody
    • CD30-L antibody
    • CD30L antibody
    • CD30LG antibody
    • MGC138144 antibody
    • TNFL8_HUMAN antibody
    • Tnfsf8 antibody
    • Tumor necrosis factor (ligand) superfamily member 8 antibody
    • Tumor necrosis factor ligand superfamily member 8 antibody
    see all

Images

  • All lanes : Anti-CD30-L antibody (ab171779) at 1 µg/ml

    Lane 1 : CD30-L-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 26 kDa

References

ab171779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up