Overview

  • Product name

  • Description

    Rabbit polyclonal to CD30-L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse CD30-L aa 68-231. (Expressed in E.coli)
    Sequence:

    MGHHHHHHSGSEFQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSW AYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLV QCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQ VNSTISVRVDNFQYVDTNTFPLDNVLS


    Database link: P32972

  • Positive control

    • WB: Recombinant mouse CD30-L protein; Rat thymus lysate.
  • General notes

    Previously labelled as CD153. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 27 kDa.

Target

  • Function

    Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD153 antibody
    • CD153 antigen antibody
    • CD30 antigen ligand antibody
    • CD30 L antibody
    • CD30 ligand antibody
    • CD30-L antibody
    • CD30L antibody
    • CD30LG antibody
    • MGC138144 antibody
    • TNFL8_HUMAN antibody
    • Tnfsf8 antibody
    • Tumor necrosis factor (ligand) superfamily member 8 antibody
    • Tumor necrosis factor ligand superfamily member 8 antibody
    see all

Images

  • Anti-CD30-L antibody (ab231208) at 2 µg/ml + Rat thymus tissue lysate

    Predicted band size: 27 kDa

  • Anti-CD30-L antibody (ab231208) at 2 µg/ml + Recombinant mouse CD30-L protein

    Predicted band size: 27 kDa

References

ab231208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up