Overview

  • Product name

  • Description

    Rabbit polyclonal to CD300a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CD300a aa 20-70 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAG K


    Database link: Q9UGN4

  • Positive control

    • IHC-P: Human lung carcinoma tissue. WB: U937 cell lysate.
  • General notes

     This product was previously labelled as CD300 antigen

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 33 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.
  • Tissue specificity

    Expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes.
  • Sequence similarities

    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD300 antigen-like family member A antibody
    • CD300a antibody
    • CD300a antigen antibody
    • CD300a molecule antibody
    • CLM-8 antibody
    • CLM8_HUMAN antibody
    • CMRF 35 H9 antibody
    • CMRF-35-H9 antibody
    • CMRF35-H antibody
    • CMRF35-H9 antibody
    • CMRF35-like molecule 8 antibody
    • CMRF35H antibody
    • CMRF35H leukocyte immunoglobulin like receptor antibody
    • CMRF35H9 antibody
    • IgSF12 antibody
    • Immunoglobulin superfamily member 12 antibody
    • Inhibitory receptor protein 60 antibody
    • IRC1 antibody
    • IRC1/IRC2 antibody
    • IRC2 antibody
    • IRp60 antibody
    • Leukocyte membrane antigen antibody
    • Mast cell derived paired immunoglobulin like receptor 1 antibody
    • NK inhibitory receptor antibody
    • Polymeric immunoglobulin receptor 4 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling CD300a with ab214357 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Anti-CD300a antibody (ab214357) at 1/300 dilution + U937 cell lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP at 1/5000 dilution

    Predicted band size: 33 kDa

References

ab214357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up