Overview

  • Product name

  • Description

    Rabbit polyclonal to CD300C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD300C aa 21-183 (extracellular). Two N-terminal tags. Expressed in E. coli.
    Sequence:

    GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVE TKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPE PSPHPGSLFSNVR


    Database link: Q08708

  • Positive control

    • WB: HepG2 cell lysate. Rat and pig liver tissue lysate. Recombinant human CD300C protein. IHC-P: Human liver, liver cancer, kidney, breast cancer and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Present on the surface of monocytes, neutrophils, a proportion of peripheral blood T- and B-lymphocytes and lymphocytic cell lines.
  • Sequence similarities

    Belongs to the CD300 family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD300 antigen-like family member C antibody
    • CD300c antibody
    • CD300c antigen antibody
    • CD300c molecule antibody
    • CLM-6 antibody
    • CLM6_HUMAN antibody
    • CMRF-35 antibody
    • CMRF-35A antibody
    • CMRF35 antibody
    • CMRF35 antigen antibody
    • CMRF35 leukocyte immunoglobulin-like receptor antibody
    • CMRF35-A1 antibody
    • CMRF35-like molecule 6 antibody
    • CMRF35A antibody
    • CMRF35A leukocyte immunoglobulin-like receptor antibody
    • CMRF35A1 antibody
    • IgSF16 antibody
    • Immunoglobulin superfamily member 16 antibody
    • LIR antibody
    see all

Images

  • All lanes : Anti-CD300C antibody (ab232789) at 2 µg/ml

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Rat liver tissue lysate
    Lane 3 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for CD300C with ab232789 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for CD300C with ab232789 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CD300C with ab232789 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for CD300C with ab232789 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CD300C with ab232789 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD300C antibody (ab232789) at 2 µg/ml + Recombinant human CD300C protein

References

ab232789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up