Anti-CD300LG antibody (ab190752)
Key features and details
- Rabbit polyclonal to CD300LG
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CD300LG antibody -
Description
Rabbit polyclonal to CD300LG -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human CD300LG aa 41-90 (internal sequence). The exact sequence is proprietary.
Sequence:EELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSL
Database link: Q6UXG3 -
Positive control
- WB: L929 cell extract.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol (glycerin, glycerine)
PBS without Mg2+ and Ca2+. -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab190752 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific peptide. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab190752 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Predicted molecular weight: 36 kDa. |
Target
-
Function
Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte. -
Tissue specificity
Highly expressed in heart, skeletal muscle and placenta. -
Sequence similarities
Belongs to the CD300 family.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Domain
Ig-like V-type domain mediates binding to lymphocyte. -
Post-translational
modificationsO-glycosylated with sialylated oligosaccharides. -
Cellular localization
Apical cell membrane. Basolateral cell membrane. Endosome > multivesicular body membrane. - Information by UniProt
-
Database links
- Entrez Gene: 146894 Human
- Omim: 610520 Human
- SwissProt: Q6UXG3 Human
- Unigene: 147313 Human
-
Alternative names
- CD300 antigen-like family member G antibody
- CD300 molecule like family member g antibody
- CD300g antibody
see all
Images
Datasheets and documents
References (0)
ab190752 has not yet been referenced specifically in any publications.