Anti-CD32A antibody (ab196829)
Key features and details
- Rabbit polyclonal to CD32A
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CD32A antibody
See all CD32A primary antibodies -
Description
Rabbit polyclonal to CD32A -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human CD32A aa 1-317.
Sequence:MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWI NVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSG EYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKP LVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKP VTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANS TDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD KNIYLTLPPNDHVNSNN
Database link: P12318 -
Positive control
- Jurkat cell line extract; HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.87% Sodium chloride
PBS is without Mg2+ and Ca2+ -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab196829 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 35 kDa. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens. -
Tissue specificity
Found on monocytes, neutrophils and eosinophil platelets. -
Sequence similarities
Contains 2 Ig-like C2-type (immunoglobulin-like) domains. -
Post-translational
modificationsPhosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2212 Human
- Omim: 146790 Human
- SwissProt: P12318 Human
- Unigene: 352642 Human
-
Alternative names
- CD32 antibody
- CD32 antigen antibody
- CDw32 antibody
see all
Images
-
Anti-CD32A antibody (ab196829) at 1/500 dilution + Jurkat cell line extract
Predicted band size: 35 kDa -
Immunofluorescent analysis of HepG2 cells labeling CD32A with ab196829 at 1/50. Lower panel shows DAPI for nuclear staining (Blue).
Protocols
Datasheets and documents
References (0)
ab196829 has not yet been referenced specifically in any publications.