Anti-CD32A antibody (ab196829)

Submit a review Submit a question
Western blot - Anti-CD32A antibody (ab196829)
  • Immunocytochemistry/ Immunofluorescence - Anti-CD32A antibody (ab196829)

Key features and details

  • Rabbit polyclonal to CD32A
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-CD32A antibody
    See all CD32A primary antibodies

  • Description

    Rabbit polyclonal to CD32A

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WB, ICC/IFmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant full length protein corresponding to Human CD32A aa 1-317.
    Sequence:

    MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWI NVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSG EYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKP LVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKP VTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANS TDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD KNIYLTLPPNDHVNSNN


    Database link: P12318
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Jurkat cell line extract; HepG2 cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab196829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

  • Tissue specificity

    Found on monocytes, neutrophils and eosinophil platelets.

  • Sequence similarities

    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

  • Post-translational
    modifications

    Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN, HCK and SYK.

  • Cellular localization

    Cell membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • CD32 antibody
      • CD32 antigen antibody
      • CDw32 antibody
      • Fc fragment of IgG, low affinity IIa, receptor (CD32) antibody
      • Fc fragment of IgG, low affinity IIa, receptor for (CD32) antibody
      • Fc gamma RII a antibody
      • Fc gamma RIIa antibody
      • Fc-gamma RII-a antibody
      • Fc-gamma-RIIa antibody
      • FCG2 antibody
      • FCG2A_HUMAN antibody
      • FcGR antibody
      • FCGR2 antibody
      • FCGR2A antibody
      • FCGR2A1 antibody
      • FcRII a antibody
      • FcRII-a antibody
      • IGFR2 antibody
      • IgG Fc receptor II a antibody
      • IgG Fc receptor II-a antibody
      • Immunoglobulin G Fc receptor II antibody
      • low affinity immunoglobulin gamma Fc region receptor II a antibody
      • Low affinity immunoglobulin gamma Fc region receptor II-a antibody
      see all

    Images

    • Western blot - Anti-CD32A antibody (ab196829)
      Western blot - Anti-CD32A antibody (ab196829)
      Anti-CD32A antibody (ab196829) at 1/500 dilution + Jurkat cell line extract

      Predicted band size: 35 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-CD32A antibody (ab196829)
      Immunocytochemistry/ Immunofluorescence - Anti-CD32A antibody (ab196829)

      Immunofluorescent analysis of HepG2 cells labeling CD32A with ab196829 at 1/50. Lower panel shows DAPI for nuclear staining (Blue).

    References (0)

    Publishing research using ab196829? Please let us know so that we can cite the reference in this datasheet.

    ab196829 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab196829.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com