Overview

  • Product name

  • Description

    Rabbit polyclonal to CD33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human CD33 aa 285-335 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    HRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEM D


    Database link: P20138

  • Positive control

    • Human gastric carcinoma tissue. FC: U937 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab203253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 40 kDa.
Flow Cyt Use at an assay dependent concentration.

Target

  • Function

    Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).
  • Tissue specificity

    Monocytic/myeloid lineage cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 33 antibody
    • CD33 antibody
    • CD33 antigen (gp67) antibody
    • CD33 antigen antibody
    • CD33 molecule antibody
    • CD33_HUMAN antibody
    • FLJ00391 antibody
    • gp67 antibody
    • My9 antibody
    • Myeloid cell surface antigen CD33 antibody
    • Myeloid cell surface antigen CD33 precursor antibody
    • Myeloid differentiation antigen CD33 antibody
    • p67 antibody
    • Sialic acid binding Ig like lectin 3 antibody
    • Sialic acid binding immunoglobulin like lectin 3 antibody
    • Sialic acid-binding Ig-like lectin 3 antibody
    • SIGLEC 3 antibody
    • Siglec-3 antibody
    • SIGLEC3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastric carcinoma tissue sections labeling CD33 with ab203253 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Flow Cytometry analysis of human U937 cells labeling CD33 with ab203253 (green). Control cells (blue), secondary only (light blue) and isotype control (orange).

References

This product has been referenced in:

  • Chen S  et al. Human telomerase reverse transcriptase recruits the ß-catenin/TCF-4 complex to transactivate chemokine (C-C motif) ligand 2 expression in colorectal cancer. Biomed Pharmacother 112:108700 (2019). Read more (PubMed: 30970512) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up