Overview

  • Product name

  • Description

    Rabbit polyclonal to CD33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD33 aa 229-259.
    Sequence:

    LNVTYVPQNPTTGIFPGDGSGKQETRAGVVH


    Database link: P20138

  • Positive control

    • PC3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro).
  • Tissue specificity

    Monocytic/myeloid lineage cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 33 antibody
    • CD33 antibody
    • CD33 antigen (gp67) antibody
    • CD33 antigen antibody
    • CD33 molecule antibody
    • CD33_HUMAN antibody
    • FLJ00391 antibody
    • gp67 antibody
    • My9 antibody
    • Myeloid cell surface antigen CD33 antibody
    • Myeloid cell surface antigen CD33 precursor antibody
    • Myeloid differentiation antigen CD33 antibody
    • p67 antibody
    • Sialic acid binding Ig like lectin 3 antibody
    • Sialic acid binding immunoglobulin like lectin 3 antibody
    • Sialic acid-binding Ig-like lectin 3 antibody
    • SIGLEC 3 antibody
    • Siglec-3 antibody
    • SIGLEC3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized PC3 cells labeling CD33 with ab221558 at 4 µg/mL (green).

References

ab221558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up