Overview

  • Product name

  • Description

    Rabbit polyclonal to CD35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD35 aa 420-550.
    Sequence:

    FCPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIR CTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSL KYECRPEYYGRPFSITCLDNLVWSSPKDVCK


    Database link: P17927

  • Positive control

    • WB: 293T whole cell lysate (ab95494), HEK-239T whole cell lysate. IHC-P: Human tonsil and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 224 kDa (predicted molecular weight: 224 kDa).

Target

  • Function

    Mediates cellular binding of particles and immune complexes that have activated complement.
  • Tissue specificity

    Present on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells.
  • Sequence similarities

    Belongs to the receptors of complement activation (RCA) family.
    Contains 30 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C3 binding protein antibody
    • C3b/C4b receptor antibody
    • C3BR antibody
    • C4BR antibody
    • CD 35 antibody
    • CD35 antibody
    • CD35 antigen antibody
    • complement component (3b/4b) receptor 1 (Knops blood group) antibody
    • complement component (3b/4b) receptor 1 including Knops blood group system antibody
    • Complement component receptor 1 antibody
    • Complement receptor 1 antibody
    • Complement receptor type 1 antibody
    • CR 1 antibody
    • CR1 antibody
    • CR1_HUMAN antibody
    • KN antibody
    • Knops blood group antigen antibody
    see all

Images

  • Anti-CD35 antibody (ab229875) at 1/1000 dilution + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 224 kDa

  • Paraffin-embedded human tonsil tissue stained for CD35 with ab229875 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for CD35 with ab229875 at a 1/100 dilution in immunohistochemical analysis.

References

ab229875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up