Overview

  • Product name

    Anti-CD38 antibody [5C5C3] - Extracellular domain
    See all CD38 primary antibodies
  • Description

    Mouse monoclonal [5C5C3] to CD38 - Extracellular domain
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CD38 aa 43-300 (extracellular). (Purified from E.coli).
    Sequence:

    VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGA FISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDM FTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTV SRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWV IHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPD KFLQCVKNPEDSSCTSEI


    Database link: P28907

  • Positive control

    • Recombinant Human CD38 (aa43-300) protein; CD38 (aa43-300)-hIgGFc transfected HEK293 cell lysate; HEK293 and LNcap cell lysates; Human endometrial cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.

Target

  • Function

    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity

    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities

    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage

    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • Acute lymphoblastic leukemia cells antigen CD38 antibody
    • ADP ribosyl cyclase 1 antibody
    • ADP ribosyl cyclase antibody
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase antibody
    • ADP-ribosyl cyclase 1 antibody
    • ADPRC 1 antibody
    • ADPRC1 antibody
    • cADPr hydrolase 1 antibody
    • CD 38 antibody
    • CD38 antibody
    • CD38 antigen (p45) antibody
    • CD38 antigen antibody
    • CD38 molecule antibody
    • Cd38-rs1 antibody
    • CD38_HUMAN antibody
    • CD38H antibody
    • Cyclic ADP ribose hydrolase antibody
    • Cyclic ADP ribose hydrolase 1 antibody
    • Cyclic ADP-ribose hydrolase 1 antibody
    • EC 3.2.2.5 antibody
    • Ecto nicotinamide adenine dinucleotide glycohydrolase antibody
    • I-19 antibody
    • I19 (mouse) antibody
    • Lymphocyte differentiation antigen CD38 antibody
    • NAD(+) nucleosidase antibody
    • NIM-R5 antigen antibody
    • NIMR5 antigen (mouse) antibody
    • OTTHUMP00000158633 antibody
    • OTTHUMP00000217743 antibody
    • p45 antibody
    • T10 antibody
    see all

Images

  • Anti-CD38 antibody [5C5C3] - Extracellular domain (ab204940) at 1/500 dilution + Recombinant Human CD38 (aa43-300) protein

    Predicted band size: 34 kDa



    Expected MWt is 56.1 kDa.

  • All lanes : Anti-CD38 antibody [5C5C3] - Extracellular domain (ab204940) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : CD38 (aa43-300)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 34 kDa

  • All lanes : Anti-CD38 antibody [5C5C3] - Extracellular domain (ab204940) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : LNcap cell lysate

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of paraffin-embedded Human endometrial cancer tissue labeling CD38 with ab204940 at 1/200 dilution with DAB staining.

References

ab204940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up