Overview

  • Product name

  • Description

    Rabbit polyclonal to CD38
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CD38 aa 199-300.
    Sequence:

    AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGRE DSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTS EI


    Database link: P28907

  • Positive control

    • IHC-P: Human tonsil tissue. WB: Daudi cell lysate. CD38 overexpression HEK-293T cell lysate. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
  • Tissue specificity

    Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
  • Sequence similarities

    Belongs to the ADP-ribosyl cyclase family.
  • Developmental stage

    Preferentially expressed at both early and late stages of the B and T-cell maturation. It is also detected on erythroid and myeloid progenitors in bone marrow, where the level of surface expression was shown to decrease during differentiation of blast-forming unit E to colony-forming unit E.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • Acute lymphoblastic leukemia cells antigen CD38 antibody
    • ADP ribosyl cyclase 1 antibody
    • ADP ribosyl cyclase antibody
    • ADP ribosyl cyclase/cyclic ADP-ribose hydrolase antibody
    • ADP-ribosyl cyclase 1 antibody
    • ADPRC 1 antibody
    • ADPRC1 antibody
    • cADPr hydrolase 1 antibody
    • CD 38 antibody
    • CD38 antibody
    • CD38 antigen (p45) antibody
    • CD38 antigen antibody
    • CD38 molecule antibody
    • Cd38-rs1 antibody
    • CD38_HUMAN antibody
    • CD38H antibody
    • Cyclic ADP ribose hydrolase antibody
    • Cyclic ADP ribose hydrolase 1 antibody
    • Cyclic ADP-ribose hydrolase 1 antibody
    • EC 3.2.2.5 antibody
    • Ecto nicotinamide adenine dinucleotide glycohydrolase antibody
    • I-19 antibody
    • I19 (mouse) antibody
    • Lymphocyte differentiation antigen CD38 antibody
    • NAD(+) nucleosidase antibody
    • NIM-R5 antigen antibody
    • NIMR5 antigen (mouse) antibody
    • OTTHUMP00000158633 antibody
    • OTTHUMP00000217743 antibody
    • p45 antibody
    • T10 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for CD38 (green) using ab244390 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human tonsil tissue stained for CD38 using ab244390 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human kidney tissue stained for CD38 using ab244390 at 1/1000 dilution in immunohistochemical analysis.

    Low expression as expected.

  • All lanes : Anti-CD38 antibody (ab244390) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : CD38 overexpression HEK-293T cell lysate
  • Anti-CD38 antibody (ab244390) at 0.4 µg/ml + Daudi (Human Burkitt's lymphoma cell line) cell lysate

References

ab244390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up