Overview

  • Product name

  • Description

    Rabbit polyclonal to CD39
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD39 aa 241-486. (Expressed in E.coli).
    Sequence:

    LYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKV VNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPY SQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFC AQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFI GKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSL


    Database link: P49961

  • Positive control

    • WB: Recombinant human CD39 protein and pig liver tissue lysate. IHC-P: Human liver and stomach cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Function

    In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation. Hydrolyzes ATP and ADP equally well.
  • Tissue specificity

    Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only.
  • Sequence similarities

    Belongs to the GDA1/CD39 NTPase family.
  • Post-translational
    modifications

    The N-terminus is blocked.
    Palmitoylated in the N-terminal part.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Form

    There are 3 isoforms produced by alternative splicing.
  • Alternative names

    • ATPDase antibody
    • CD 39 antibody
    • CD39 antibody
    • CD39 antigen antibody
    • DKFZp686D194 antibody
    • DKFZp686I093 antibody
    • Ecto apyrase antibody
    • Ecto ATP diphosphohydrolase antibody
    • Ecto-apyrase antibody
    • Ecto-ATP diphosphohydrolase 1 antibody
    • Ecto-ATPase 1 antibody
    • Ecto-ATPDase 1 antibody
    • Ectonucleoside triphosphate diphosphohydrolase 1 antibody
    • ENTP1_HUMAN antibody
    • ENTPD 1 antibody
    • ENTPD1 antibody
    • FLJ40921 antibody
    • FLJ40959 antibody
    • Lymphoid cell activation antigen antibody
    • NTPDase 1 antibody
    • NTPDase1 antibody
    • SPG64 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CD39 using ab231983 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for CD39 using ab231983 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD39 antibody (ab231983) at 2 µg/ml + Recombinant human CD39 protein

    Developed using the ECL technique.

    Predicted band size: 58 kDa

  • Anti-CD39 antibody (ab231983) at 5 µg/ml + Pig liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 58 kDa

References

ab231983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up