Overview

  • Product name

    Anti-CD39 antibody [IMG17B5F11]
    See all CD39 primary antibodies
  • Description

    Mouse monoclonal [IMG17B5F11] to CD39
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CD39 aa 102-208.
    Sequence:

    GIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDV VERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPY ETNNQET


    Database link: P49961

  • Positive control

    • Human, mouse and rat brain lysates; Human spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab178572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 58 kDa.
IHC-P Use a concentration of 5 µg/ml.

Target

  • Function

    In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation. Hydrolyzes ATP and ADP equally well.
  • Tissue specificity

    Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only.
  • Sequence similarities

    Belongs to the GDA1/CD39 NTPase family.
  • Post-translational
    modifications

    The N-terminus is blocked.
    Palmitoylated in the N-terminal part.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Form

    There are 3 isoforms produced by alternative splicing.
  • Alternative names

    • ATPDase antibody
    • CD 39 antibody
    • CD39 antibody
    • CD39 antigen antibody
    • DKFZp686D194 antibody
    • DKFZp686I093 antibody
    • Ecto apyrase antibody
    • Ecto ATP diphosphohydrolase antibody
    • Ecto-apyrase antibody
    • Ecto-ATP diphosphohydrolase 1 antibody
    • Ecto-ATPase 1 antibody
    • Ecto-ATPDase 1 antibody
    • Ectonucleoside triphosphate diphosphohydrolase 1 antibody
    • ENTP1_HUMAN antibody
    • ENTPD 1 antibody
    • ENTPD1 antibody
    • FLJ40921 antibody
    • FLJ40959 antibody
    • Lymphoid cell activation antigen antibody
    • NTPDase 1 antibody
    • NTPDase1 antibody
    • SPG64 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded normal Human spleen tissue labeling CD39 with ab178572 at 5 µg/ml, followed by peroxidase-conjugate and DAB chromogen.

  • All lanes : Anti-CD39 antibody [IMG17B5F11] (ab178572) at 1 µg/ml

    Lane 1 : Human brain lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Rat brain lysate
    Lane 4 : Recombinant Human CD39 protein fragment

    Predicted band size: 58 kDa

References

This product has been referenced in:

  • Aliagas E  et al. Is the purinergic pathway involved in the pathology of COPD? Decreased lung CD39 expression at initial stages of COPD. Respir Res 19:103 (2018). Read more (PubMed: 29807526) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up