Overview

  • Product name

    Anti-CD42b antibody [6H6H10]
    See all CD42b primary antibodies
  • Description

    Mouse monoclonal [6H6H10] to CD42b
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD42b aa 17-183 (extracellular). (Expressed in E.coli).
    Sequence:

    HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLAT LMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLP ALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKL EKLSLANNNLTELPAGL


    Database link: P07359

  • Positive control

    • WB: HL-60, MOLT-4 and Ramos celll lysates; CD42b (aa 17-183)-hIgGFc transfected HEK-293 cell lysate; Human CD42b (aa 17-183) recombinant protein. Flow Cyt: HL-60 and Jurkat cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6H6H10
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 72 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Relevance

    CD42b is a platelet activation marker involved in the process of coagulation as an aggregating factor. It interacts with extracellular matrix as well as with adhesion molecules. Its expression and activation seems to be regulated by VEGF and PDGF.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Antigen CD42b alpha antibody
    • BDPLT1 antibody
    • BDPLT3 antibody
    • BSS antibody
    • CD 42b antibody
    • CD42b alpha antibody
    • CD42B antibody
    • CD42b antigen antibody
    • DBPLT3 antibody
    • GLYCOCALICIN antibody
    • Glycoprotein Ib (platelet) alpha polypeptide antibody
    • Glycoprotein Ibalpha antibody
    • GP Ib alpha antibody
    • GP1B antibody
    • GP1BA antibody
    • GPIb alpha antibody
    • GPIbA antibody
    • MGC34595 antibody
    • Platelet glycoprotein Ib alpha chain antibody
    • Platelet glycoprotein Ib alpha polypeptide antibody
    • Platelet membrane glycoprotein 1b alpha subunit antibody
    • VWDP antibody
    see all

Images

  • Anti-CD42b antibody [6H6H10] (ab233794) at 1/500 dilution + Human CD42b (aa 17-183) recombinant protein

    Predicted band size: 72 kDa



    Expected MW is 44.2 kDa.

  • All lanes : Anti-CD42b antibody [6H6H10] (ab233794) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : CD42b (aa 17-183)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 72 kDa

  • All lanes : Anti-CD42b antibody [6H6H10] (ab233794) at 1/500 dilution

    Lane 1 : HL-60 (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : MOLT-4 (human lymphoblastic leukemia cell line) cell lysate
    Lane 3 : Ramos (human Burkitt's lymphoma cell line) cell lysate

    Predicted band size: 72 kDa

  • Flow cytometric analysis of HL-60 (human promyelocytic leukemia cell line) cells labeling CD42b with ab233794 at 1/200 dilution (green) compared with a negative control (red).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling CD42b with ab233794 at 1/200 dilution (green) compared with a negative control (red).

References

ab233794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up