Overview

  • Product name

  • Description

    Rabbit polyclonal to CD42d/GP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CD42d/GP5 aa 17-242. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    QPFPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHILLFGMGRGVLQ SQSFSGMTVLQRLMISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGA LLDKMVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLF TNLENLKLLDLSGNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNS LGALTELQFHRNHIRSIAPGAFDRLP


    Database link: P40197

  • Positive control

    • IHC-P: Human lung tissue. WB: Recombinant human CD42d/GP5 protein; Human platelet lysate.
  • General notes

     This product was previously labelled as CD42d

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis.
  • Tissue specificity

    Platelets and megakaryocytes.
  • Sequence similarities

    Contains 13 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 42d antibody
    • CD42d antibody
    • CD42d antigen antibody
    • Glycoprotein 5 antibody
    • Glycoprotein V antibody
    • Glycoprotein V platelet antibody
    • GlycoproteinV antibody
    • Gp 5 antibody
    • GP V antibody
    • GP5 antibody
    • GPV antibody
    • GPV_HUMAN antibody
    • Platelet glycoprotein V antibody
    • Platelet glycoprotein V precursor antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung tissue stained for CD42d/GP5 using ab233513 at 20 µg/mL in immunhistochemical analysis. DAB staining.

  • Anti-CD42d/GP5 antibody (ab233513) at 5 µg/ml + Human platelet tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-CD42d/GP5 antibody (ab233513) at 2 µg/ml + Recombinant human CD42d/GP5 protein

References

ab233513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up