Overview

  • Product name

    Anti-CD43 antibody [TP1/36]
    See all CD43 primary antibodies
  • Description

    Mouse monoclonal [TP1/36] to CD43
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human CD43 aa 20-400. (Purified from myeloblastic KG1 cells).
    Sequence:

    STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPST SINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVP ITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPL TMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGAS GPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIV LVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTV GGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSL KGEEEPLVASEDGAVDAPAPDEPEGGDGAAP


    Database link: P16150

  • Positive control

    • Human peripheral blood lymphocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab221236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1µg for 106 cells.

Target

  • Function

    One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochemical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter receptor for SN/Siglec-1 (By similarity). During T-cell activation is actively removed from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response.
  • Tissue specificity

    Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
  • Post-translational
    modifications

    Glycosylated; has a high content of sialic acid and O-linked carbohydrate structures.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 43 antibody
    • CD43 antibody
    • CD43 antigen antibody
    • Galactoglycoprotein antibody
    • GALGP antibody
    • GPL 115 antibody
    • GPL115 antibody
    • Human gene for sialophorin antibody
    • Leucocyte sialoglycoprotein antibody
    • LEUK_HUMAN antibody
    • Leukocyte large sialoglycoprotein antibody
    • Leukocyte sialoglycoprotein antibody
    • Leukosialin antibody
    • LSN antibody
    • Ly-48 antibody
    • sialophorin (gpL115, leukosialin, CD43) antibody
    • Sialophorin antibody
    • Spn antibody
    see all

Images

  • Flow cytometric analysis of human peripheral blood lymphocytes labeling CD43 with ab221236, followed by FITC anti-Human IgG.

    The histogram is a biparametric representation (side scatter versus fluorescence intensity) of a lysate normal whole blood sample gated on leucocytes.

References

ab221236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up