Overview

  • Product name

  • Description

    Rabbit polyclonal to CD47
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human CD47 aa 280-323 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE


    Database link: Q08722

  • Positive control

    • Rat tongue tissue; RSC96 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/20 - 1/100.
WB 1/500.

Target

  • Function

    Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
  • Tissue specificity

    Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen identified by monoclonal antibody 1D8 antibody
    • Antigenic surface determinant protein OA3 antibody
    • CD 47 antibody
    • CD47 antibody
    • CD47 antigen (Rh-related antigen, integrin-associated signal transducer) antibody
    • CD47 antigen antibody
    • CD47 glycoprotein antibody
    • CD47 molecule antibody
    • CD47_HUMAN antibody
    • IAP antibody
    • Integrin Associated Protein antibody
    • Integrin associated signal transducer antibody
    • Integrin-associated protein antibody
    • Leukocyte surface antigen CD47 antibody
    • MER 6 antibody
    • MER6 antibody
    • OA 3 antibody
    • OA3 antibody
    • OTTHUMP00000041152 antibody
    • OTTHUMP00000041153 antibody
    • Protein MER6 antibody
    • Rh related antigen antibody
    • Surface antigen identified by monoclonal antibody 1D8 antibody
    see all

Images

  • Anti-CD47 antibody (ab214453) at 1/500 dilution + Mouse brain lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat tongue tissue labeling CD47 with ab214453 at 1/200 dilution, followed by conjugation to the secondary antibody.

  • Flow cytometric analysis of RSC96 cells labeling CD47 with ab214453 at 1/100 for 30 minutes followed by incubation with a PE conjugated secondary antibody for 30 minutes (green) compared to control cells (blue), secondary only (light blue) and isotype control (orange).

References

ab214453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up