Overview

  • Product name

  • Description

    Rabbit polyclonal to CD5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human CD5 aa 25-372. N-terminal His-tag and GST-tag; expressed in E.coli.
    Sequence:

    RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDP SQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDM CHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVV EFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDP GEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKV QSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSV NSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP


    Database link: P06127

  • Positive control

    • WB: A549 and HepG2 cell lysate; Recombinant human CD5 protein. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 55 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CD5 using ab232713 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-CD5 antibody (ab232713) at 1 µg/ml + Recombinant human CD5 protein

    Predicted band size: 55 kDa

  • Anti-CD5 antibody (ab232713) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 55 kDa

  • Anti-CD5 antibody (ab232713) at 1 µg/ml + A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 55 kDa

References

ab232713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up