Overview

  • Product name

  • Description

    Rabbit polyclonal to CD53
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CD53 aa 100-180.
    Sequence:

    AILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGING TSDWTSGPPASCPSDRKVEGCYAKARLWFHS


    Database link: P19397

  • Positive control

    • IHC-P: Human tonsil and gastric cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in growth regulation in hematopoietic cells.
  • Tissue specificity

    B-cells, monocytes, macrophages, neutrophils, single (CD4 or CD8) positive thymocytes and peripheral T-cells.
  • Sequence similarities

    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI323659 antibody
    • Antigen MOX44 identified by monoclonal antibody MRC-OX44 antibody
    • CD 53 antibody
    • CD53 antibody
    • CD53 antigen antibody
    • CD53 antigen, isoform CRA_b antibody
    • CD53 glycoprotein antibody
    • Cd53 molecule antibody
    • CD53 tetraspan antigen antibody
    • CD53_HUMAN antibody
    • Cell surface glycoprotein CD53 antibody
    • Leukocyte antigen MRC OX-44 antibody
    • Leukocyte surface antigen CD53 antibody
    • MOX 44 antibody
    • MOX44 antibody
    • OTTHUMP00000059505 antibody
    • Ox-44 antibody
    • OX44 antibody
    • RATOX44 antibody
    • Tetraspanin 25 antibody
    • Tetraspanin-25 antibody
    • Tetraspanin25 antibody
    • Transmembrane glycoprotein antibody
    • TSPAN 25 antibody
    • Tspan-25 antibody
    • TSPAN25 antibody
    see all

Images

  • Paraffin-embedded human gastric cancer tissue stained for CD53 using ab230203 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for CD53 using ab230203 at 1/100 dilution in immunohistochemical analysis.

References

ab230203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up