Overview

  • Product name

  • Description

    Rabbit polyclonal to CD55
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat CD55 aa 254-372. Expressed in E. coli.
    Sequence:

    PHESTLINFPSTRAPLSHKPTTVKVPGTRVKPTSHKPTEVKVPATQHVPV SKTTVRHPTRTSKDRGESNSGGDHFIYGFVAVIVTIDSIILIKTLWWTIL SSNRSSDLQGKKKRENVPE


    Database link: Q9QYJ9

  • Positive control

    • WB: Recombinant rat CD55 protein. Rat testis and placenta lysate. Mouse testis lysate. A549 cell lysate. IHC-P: Rat pancreas and intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade.
  • Tissue specificity

    Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.
  • Sequence similarities

    Belongs to the receptors of complement activation (RCA) family.
    Contains 4 Sushi (CCP/SCR) domains.
  • Domain

    The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3.
  • Post-translational
    modifications

    The Ser/Thr-rich domain is heavily O-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 55 antibody
    • CD55 antibody
    • CD55 antigen antibody
    • CD55 Cromer blood group system antibody
    • CD55 molecule (Cromer blood group) antibody
    • CD55 molecule antibody
    • CD55 molecule, decay accelerating factor for complement (Cromer blood group) antibody
    • Cd55a antibody
    • Complement decay accelerating factor antibody
    • Complement decay-accelerating factor antibody
    • Complement decay-accelerating factor, GPI-anchored antibody
    • CR antibody
    • CROM antibody
    • Cromer Blood Group antigen antibody
    • Cromer blood group system antibody
    • DAF antibody
    • Daf-GPI antibody
    • DAF_HUMAN antibody
    • Daf1 antibody
    • Dcay accelerating factor for complement (CD55, Cromer blood group system) antibody
    • Decay accelarating factor 1, isoform CRA_a antibody
    • Decay accelerating factor (GPI-form) antibody
    • Decay Accelerating Factor for Complement antibody
    • Decay accelerating factor GPI-form antibody
    • Decay accelerating factor soluble-form antibody
    • GPI-DAF antibody
    • TC antibody
    see all

Images

  • All lanes : Anti-CD55 antibody (ab231061) at 2 µg/ml

    Lane 1 : Rat testis tissue lysate
    Lane 2 : Rat placenta tissue lysate
    Lane 3 : Mouse testis tissue lysate
    Lane 4 : A549 (Human lung carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for CD55 with ab231061 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat intestine tissue stained for CD55 with ab231061 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CD55 antibody (ab231061) at 2 µg/ml + recombinant rat CD55 protein

    Developed using the ECL technique.

References

ab231061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up